KEGG   Bernardetia litoralis: Fleli_3543Help
Entry
Fleli_3543        CDS       T02149                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fli  Bernardetia litoralis
Pathway
fli00230  Purine metabolism
fli01100  Metabolic pathways
Module
fli_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Fleli_3543
Enzymes [BR:fli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Fleli_3543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_24 AAA_19 AAA_22 AAA_16 AAA_33 AAA_30 DUF3496 DUF1965 RsgA_GTPase YtxH ABC_tran cobW
Motif
Other DBs
NCBI-ProteinID: AFM05862
UniProt: I4APH7
Position
4213651..4214265
Genome map
AA seq 204 aa AA seqDB search
MSQKLIIFSAPSGAGKTTIVKHLLSVYPKTLSFSISATTRSPRAYEKPSQDYYFISVEEF
RKKIDNKAFIEYEQVYDGLYYGTLRSEVERLWSEGKVVVFDVDVKGGVALKQEFQEAALA
VFVKPPSITELRKRLLSRQTETDETLKERVEKAEIEMEFAPFFDEVVINDSLSEALDYSE
KIVEEFISKKPQHNHHQHHKNITL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaagctaattattttctcagccccttctggagctggcaaaactaccatcgtc
aaacacttattgagtgtttatcccaaaactttgagtttttcaatttctgctactactcgc
tcgcctcgggcttatgaaaaaccaagtcaagattattattttatttctgttgaagaattt
agaaaaaaaattgataataaagcatttatagagtacgaacaagtctatgacggactttat
tatggaacattacgaagcgaagtcgaacggctttggagtgaaggaaaagttgttgtcttt
gatgtagatgtaaaaggaggagttgctcttaaacaagagtttcaagaagctgctcttgct
gtatttgtaaaaccaccatccataacagaacttcgaaaaaggcttttatctcgccaaaca
gaaacagacgaaacactaaaagaaagagtagaaaaagctgaaatagaaatggaatttgct
cctttctttgatgaggttgtaattaatgattcacttagtgaagccctagattatagcgaa
aaaatagtagaagaatttatttccaagaagcctcaacacaatcatcatcaacatcataaa
aatataactctatga

DBGET integrated database retrieval system