KEGG   Flexibacter litoralis: Fleli_3543Help
Entry
Fleli_3543        CDS       T02149                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fli  Flexibacter litoralis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fli00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4213651..4214265
Genome map
AA seq 204 aa AA seqDB search
MSQKLIIFSAPSGAGKTTIVKHLLSVYPKTLSFSISATTRSPRAYEKPSQDYYFISVEEF
RKKIDNKAFIEYEQVYDGLYYGTLRSEVERLWSEGKVVVFDVDVKGGVALKQEFQEAALA
VFVKPPSITELRKRLLSRQTETDETLKERVEKAEIEMEFAPFFDEVVINDSLSEALDYSE
KIVEEFISKKPQHNHHQHHKNITL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaagctaattattttctcagccccttctggagctggcaaaactaccatcgtc
aaacacttattgagtgtttatcccaaaactttgagtttttcaatttctgctactactcgc
tcgcctcgggcttatgaaaaaccaagtcaagattattattttatttctgttgaagaattt
agaaaaaaaattgataataaagcatttatagagtacgaacaagtctatgacggactttat
tatggaacattacgaagcgaagtcgaacggctttggagtgaaggaaaagttgttgtcttt
gatgtagatgtaaaaggaggagttgctcttaaacaagagtttcaagaagctgctcttgct
gtatttgtaaaaccaccatccataacagaacttcgaaaaaggcttttatctcgccaaaca
gaaacagacgaaacactaaaagaaagagtagaaaaagctgaaatagaaatggaatttgct
cctttctttgatgaggttgtaattaatgattcacttagtgaagccctagattatagcgaa
aaaatagtagaagaatttatttccaagaagcctcaacacaatcatcatcaacatcataaa
aatataactctatga

DBGET integrated database retrieval system