KEGG   Flexibacter litoralis: Fleli_3543Help
Entry
Fleli_3543        CDS       T02149                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fli  Flexibacter litoralis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Fleli_3543
Enzymes [BR:fli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Fleli_3543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4213651..4214265
Genome map
AA seq 204 aa AA seqDB search
MSQKLIIFSAPSGAGKTTIVKHLLSVYPKTLSFSISATTRSPRAYEKPSQDYYFISVEEF
RKKIDNKAFIEYEQVYDGLYYGTLRSEVERLWSEGKVVVFDVDVKGGVALKQEFQEAALA
VFVKPPSITELRKRLLSRQTETDETLKERVEKAEIEMEFAPFFDEVVINDSLSEALDYSE
KIVEEFISKKPQHNHHQHHKNITL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaagctaattattttctcagccccttctggagctggcaaaactaccatcgtc
aaacacttattgagtgtttatcccaaaactttgagtttttcaatttctgctactactcgc
tcgcctcgggcttatgaaaaaccaagtcaagattattattttatttctgttgaagaattt
agaaaaaaaattgataataaagcatttatagagtacgaacaagtctatgacggactttat
tatggaacattacgaagcgaagtcgaacggctttggagtgaaggaaaagttgttgtcttt
gatgtagatgtaaaaggaggagttgctcttaaacaagagtttcaagaagctgctcttgct
gtatttgtaaaaccaccatccataacagaacttcgaaaaaggcttttatctcgccaaaca
gaaacagacgaaacactaaaagaaagagtagaaaaagctgaaatagaaatggaatttgct
cctttctttgatgaggttgtaattaatgattcacttagtgaagccctagattatagcgaa
aaaatagtagaagaatttatttccaagaagcctcaacacaatcatcatcaacatcataaa
aatataactctatga

DBGET integrated database retrieval system