KEGG   Flexibacter litoralis: Fleli_3554Help
Entry
Fleli_3554        CDS       T02149                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fli  Flexibacter litoralis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4241646..4243157)
Genome map
AA seq 503 aa AA seqDB search
MAYNKLKGEQLLELKTIQDLKNAGYRSKSIKEELRDNLIHSLQNNENPFEGIYGYEETVI
PDIERAILSRHNINLLGLRGQAKTRIARLMVGLLDEYIPIVKGSELNDDPLNPLSRFAKD
LIAEHGENTEIEWLNRSERYTEKLATPDVTVSDLIGDVDPIRAANLKLNYSDERVINFGL
IPRSHRCIFVINELPDLQARIQVALFNILQEGDIQIRGFKLRLPLDIQFVFTANPEDYTN
RGSIVTPLKDRIGSQIITHYPTTLEISKKITHQESSLAKEQKEKIKVGEIATDLVEQISF
VARDSEYVDEKSGVSARLTISAYENLVSAAERRMLINNEKTTSVRMSDFRGVVPAIAGKI
ELVYEGEQEGAGIVAESLINKAIREQFLNYFPDPEKQKKLKEDGLYYMMLKWFGDGNTVD
IMNDASKKEYEKQLKQVPLLDKIVSKKYPKVKGDEKLFLMEFLLHGLAEYSALNKNILAN
GLVFKDLFSSMFSMPESDEENEY
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaataaactcaaaggcgaacaacttttagaactcaaaactattcaagacctt
aaaaatgcaggttatcggtctaaatcaataaaagaagaattaagagataatctaattcat
agcctacaaaacaacgaaaatccatttgaaggaatttatggatatgaagaaactgttatt
ccagatatagaaagagccattttgtcacgtcataatataaatcttttgggacttcgtggg
caagccaaaacacgtattgctcgcctgatggttggtcttttggatgaatatattcctatt
gtgaaaggctcagaactcaatgatgaccctttgaatcctctttctcgttttgcaaaagat
ttgatagcagaacatggagaaaatacagaaattgaatggttaaatagaagcgaacgctat
actgaaaaattagcaactcctgatgtaactgtttcggatttgattggtgatgtcgatcct
attcgtgcagcaaatttaaaattgaattattctgatgagcgagttattaattttggtctt
attccacgttcgcatcgttgtatttttgtaattaatgaacttcctgaccttcaagcacgt
attcaagttgctttatttaatattttacaagaaggagatattcagattcgtggcttcaaa
ttgcgcttacctttggatattcagtttgtttttactgccaatcctgaagattataccaat
cgtggaagtatcgtaactcctctaaaagatagaattggaagtcagattattacgcattat
ccaactactttagagattagtaaaaaaattacacatcaagaatctagtctagcaaaagag
caaaaagaaaaaataaaagtaggcgaaattgcaactgatttggtagaacaaatttcattt
gtggcaagagatagcgaatatgtagatgaaaaaagtggtgtttcggctcgcttgactatt
tctgcctatgaaaatttggtttcggctgctgaaagaagaatgcttataaataatgaaaaa
acaacttctgtcagaatgagtgactttagaggtgtcgttcctgccattgctggtaaaata
gaattggtttatgaaggcgaacaagaaggcgcaggaattgtagccgaaagtttgataaat
aaagctattcgtgagcaatttttaaattattttccagacccagaaaaacaaaagaaactc
aaagaagatggtttgtattatatgatgctcaaatggtttggagatggaaatacggttgat
attatgaatgatgcttcaaaaaaagaatatgaaaaacaattaaagcaagttcctttattg
gataaaattgtaagcaaaaaatatccaaaagtaaaaggcgatgaaaagctatttttgatg
gaattcttattacacggcttggctgaatattctgctcttaacaaaaatattttagcaaat
ggtcttgtatttaaagatttatttagttcaatgttttcaatgcctgaatctgatgaggag
aatgaatactaa

DBGET integrated database retrieval system