KEGG   Flexibacter litoralis: Fleli_3653Help
Entry
Fleli_3653        CDS       T02149                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fli  Flexibacter litoralis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fleli_3653
  Amino acid metabolism
   00340 Histidine metabolism
    Fleli_3653
Enzymes [BR:fli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Fleli_3653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4360747..4362087)
Genome map
AA seq 446 aa AA seqDB search
MVCQKISFLCSLFIQKKIAFTFPMKIYNQPARNEWESICTRPTFSLKQIESQVQNVLNSI
KEKGDTAIQKFTKDFDKIDLKNFKVSTEEIAEAENLVSDSLKKAINHAYQNILVFHQSQI
ETVKKIEITKGITCWRKSVGIEKVGLYIPGGTAPLFSTVLMLGIPAKIAGCKKIVLCSPP
NKEGKIHPAILYAAHLVGATDIFKIGGIQAIGAMAYGTESVSKVYKIFGPGNQYVTVAKQ
LIQNEGIAIDMPAGPSEVAVLADKSCVPSFVAADLLSQAEHGKDSQVILMTDNEQTANQI
KIEVEKQLESLPRKDFAQKSLENSRFVILKNRQEILDMSNFYAPEHLIIALENPEEAAEH
IINAGSVFLGNYTPESVGDYASGTNHTLPTDGHARAYSGVSLDSFIKKITFQSLTKEGLN
QIGQTVIEMAETEELKAHANAVRVRL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtcaaaagattagtttcctttgctcactattcattcaaaaaaaaatagcattt
acttttccaatgaaaatatacaaccaacctgctcgcaacgaatgggaatctatctgtaca
cgtcctactttttctttaaaacaaattgaatctcaagttcagaatgttctaaattctatc
aaagaaaaaggcgatacagccattcaaaaattcacaaaagattttgataaaatagattta
aaaaattttaaagtaagcacagaagaaattgcagaagctgaaaacctcgtttctgattct
cttaaaaaagctatcaatcacgcttatcaaaacatcttagttttccaccaaagccaaata
gaaacggtcaaaaaaattgaaatcacaaaaggtattacctgttggagaaaaagtgtgggt
atcgaaaaagtaggtttgtatattccagggggaactgctccacttttttctactgttttg
atgctcggtattcctgccaaaattgctggttgtaagaaaattgttttatgttcgcctcct
aataaagagggaaaaatccaccctgctattttatatgctgctcatcttgtaggtgcaaca
gatattttcaaaattggaggaatacaagcgattggtgcaatggcttatggaacagaatct
gtatcaaaagtatataaaatttttggccctggaaatcagtatgtaacagttgcaaaacag
ctcattcaaaatgaaggaattgcgattgatatgcctgctggcccttctgaagtagctgtt
ttggctgataaaagttgtgttcctagttttgtagctgctgatttgctttcacaggccgaa
catggaaaagacagtcaggttattttgatgacggataatgaacaaacagcaaatcaaata
aaaatagaagtagagaaacaattagaatcactacctagaaaagattttgctcaaaaatca
ttagaaaatagccgttttgtaatcttaaaaaacagacaagaaattttggatatgagtaat
ttttatgcacctgagcatttgattattgctttagaaaatccagaagaggcagccgaacat
ataatcaatgcaggctctgtatttttggggaattacacacccgaatcagttggagattat
gcttctggaacaaatcacacactaccaacagacggacatgcaagagcttatagtggagtt
tctttagatagttttatcaaaaaaataacgtttcaatcacttacaaaagaaggattgaat
caaataggacaaacagtaattgagatggctgaaactgaagaattaaaggcgcatgccaat
gctgttcgtgttagattataa

DBGET integrated database retrieval system