KEGG   Flexibacter litoralis: Fleli_3747Help
Entry
Fleli_3747        CDS       T02149                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fli  Flexibacter litoralis
Brite
Enzymes [BR:fli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Fleli_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4485919..4486662
Genome map
AA seq 247 aa AA seqDB search
MQKDSYKHQGLRRQLVDEIIKMGIKDEQVLNAILTVPRHFFMDSAFLEHAYQNKAFSIGE
GQTISQPYTVAYQSELLNLKDLEISNTVKKNAFKILEIGTGSGYQAAILAYICKNKNVDI
TSIEYHKNIHQKAQQTLENLYTYLEEFNFDVLKWTDFVQGDGSKGFIQNAPYDRILVTAA
TPNSPQSFKEWFNQLNIGGQIIVPVGNRKNQIMCRYTKKDEKTIEQENFGGFRFVPLLGE
KGFDNIL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagatagttacaaacatcaaggattacgaagacaacttgtcgacgaaattata
aaaatgggaataaaagatgagcaggttttgaatgctatcttgactgttcctaggcatttt
tttatggatagtgcttttttagaacatgcttatcaaaataaagccttttctattggagaa
gggcaaactatttctcagccttatacagttgcttatcaaagtgagcttttgaacttgaaa
gatttagagataagcaacaccgtgaaaaaaaatgctttcaaaatacttgagataggaaca
ggttcgggatatcaagcagccattttagcctacatttgtaaaaataaaaatgttgatatt
acaagtatagaatatcacaaaaatattcatcaaaaagcacaacaaacattagaaaattta
tatacttatttggaagagtttaattttgatgtcttgaaatggacagattttgttcaagga
gatggctcaaaaggctttattcaaaatgctccttatgataggattttggtaacggcagcc
acgccaaattctcctcaaagttttaaagaatggtttaatcaattaaatattggaggacaa
ataattgttcctgttgggaatcgtaaaaatcagattatgtgccgttataccaaaaaagac
gaaaaaactatcgaacaagaaaattttggaggttttcgttttgtgcctcttttgggagaa
aagggttttgataatatattgtag

DBGET integrated database retrieval system