KEGG   Bernardetia litoralis: Fleli_3992Help
Entry
Fleli_3992        CDS       T02149                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fli  Bernardetia litoralis
Pathway
fli00020  Citrate cycle (TCA cycle)
fli00640  Propanoate metabolism
fli00660  C5-Branched dibasic acid metabolism
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
fli01120  Microbial metabolism in diverse environments
fli01130  Biosynthesis of antibiotics
fli01200  Carbon metabolism
Module
fli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fleli_3992
   00640 Propanoate metabolism
    Fleli_3992
   00660 C5-Branched dibasic acid metabolism
    Fleli_3992
Enzymes [BR:fli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Fleli_3992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AFM06294
UniProt: I4AQQ9
Position
complement(4792607..4793821)
Genome map
AA seq 404 aa AA seqDB search
MNIHEYQGKELLKKYGVAIQEGIVVDSADKVVEASKELREQTGTDWIVVKAQIHAGGRGK
GTVVGTDYNGVMLGKSPEDAAEKAKQLLGNVLVTHQTGEEGKKVNKVLLAQDVYYKGESE
IKEFYVAVLLDRDKNCNVIMASREGGMDIEEVAESNPDAIIKEWIDPKLGLQPFQAQKVA
FALGLKGKALKEMTKFIKSLYAAYIGIDASQVEINPAFKTSDDRVLAVDSKIDLDDNAFY
RHKDLAALRDESEESPLEVEASQFGLNYVKLDGNVGCMVNGAGLAMATMDMIKLAGGEPA
NFLDVGGGASAETVEKGFRIILKDPNVKAILINIFGGIVRCDRVANGVVEAYKNIGKIDV
PIIVRLQGTNAEEGAEIIKGSGLNVISATVLKEAADRVKEVLAN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcaaggtaaagaactactcaaaaaatacggagttgcaattcaa
gaaggaatcgtagtagattctgctgacaaagttgttgaggcatctaaagaacttagagag
caaacaggtacagattggattgtagttaaagcacaaattcacgcaggtggacgtggaaaa
ggaacagttgtaggtacagattataatggcgtaatgctaggaaaatctcctgaagatgct
gctgaaaaagcaaaacaacttcttggaaatgtacttgtaactcaccaaacaggtgaagaa
ggcaaaaaagtaaataaggttttgttagcgcaagatgtttattacaaaggagagtctgaa
atcaaagagttttatgtagctgttcttttggacagagacaaaaactgtaacgtgattatg
gctagtagagaaggtggaatggacatcgaagaagttgctgaaagtaatcctgatgcaatt
atcaaagaatggattgatccaaaattaggtttgcaacctttccaagctcaaaaagtagca
tttgctttaggtttaaaaggaaaagcacttaaagaaatgactaaatttatcaaatcttta
tatgctgcatatattggaattgatgcttctcaagtagaaattaatcctgctttcaaaact
tcggatgatagagttttggcagtagattcaaaaattgatcttgatgataatgctttttat
cgtcataaagatttggctgctcttagagatgagtctgaagaatctccattagaagtagaa
gcaagtcaatttggcttaaattacgtaaaacttgacggaaatgttgggtgtatggtaaat
ggtgctggtcttgcaatggctacaatggatatgattaaacttgctggtggtgagcctgct
aacttcctagacgttgggggtggggcatctgctgaaacagtagaaaaaggtttccgtatt
atcttgaaagatccaaatgtaaaagctattttaattaatatttttggtggtattgttcgt
tgtgacagagttgcaaacggagtagtagaagcctacaaaaatattggaaaaattgatgtg
ccaattatcgttcgtctgcaaggaacaaacgcagaagaaggagcagaaattattaaaggc
tctggattaaatgtaatttcagcaacagttttgaaagaagctgctgacagagtaaaagaa
gtattagccaactaa

DBGET integrated database retrieval system