KEGG   Flexibacter litoralis: Fleli_3992Help
Entry
Fleli_3992        CDS       T02149                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fli  Flexibacter litoralis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fleli_3992
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fleli_3992
   00640 Propanoate metabolism
    Fleli_3992
   00660 C5-Branched dibasic acid metabolism
    Fleli_3992
Enzymes [BR:fli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Fleli_3992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4792607..4793821)
Genome map
AA seq 404 aa AA seqDB search
MNIHEYQGKELLKKYGVAIQEGIVVDSADKVVEASKELREQTGTDWIVVKAQIHAGGRGK
GTVVGTDYNGVMLGKSPEDAAEKAKQLLGNVLVTHQTGEEGKKVNKVLLAQDVYYKGESE
IKEFYVAVLLDRDKNCNVIMASREGGMDIEEVAESNPDAIIKEWIDPKLGLQPFQAQKVA
FALGLKGKALKEMTKFIKSLYAAYIGIDASQVEINPAFKTSDDRVLAVDSKIDLDDNAFY
RHKDLAALRDESEESPLEVEASQFGLNYVKLDGNVGCMVNGAGLAMATMDMIKLAGGEPA
NFLDVGGGASAETVEKGFRIILKDPNVKAILINIFGGIVRCDRVANGVVEAYKNIGKIDV
PIIVRLQGTNAEEGAEIIKGSGLNVISATVLKEAADRVKEVLAN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcaaggtaaagaactactcaaaaaatacggagttgcaattcaa
gaaggaatcgtagtagattctgctgacaaagttgttgaggcatctaaagaacttagagag
caaacaggtacagattggattgtagttaaagcacaaattcacgcaggtggacgtggaaaa
ggaacagttgtaggtacagattataatggcgtaatgctaggaaaatctcctgaagatgct
gctgaaaaagcaaaacaacttcttggaaatgtacttgtaactcaccaaacaggtgaagaa
ggcaaaaaagtaaataaggttttgttagcgcaagatgtttattacaaaggagagtctgaa
atcaaagagttttatgtagctgttcttttggacagagacaaaaactgtaacgtgattatg
gctagtagagaaggtggaatggacatcgaagaagttgctgaaagtaatcctgatgcaatt
atcaaagaatggattgatccaaaattaggtttgcaacctttccaagctcaaaaagtagca
tttgctttaggtttaaaaggaaaagcacttaaagaaatgactaaatttatcaaatcttta
tatgctgcatatattggaattgatgcttctcaagtagaaattaatcctgctttcaaaact
tcggatgatagagttttggcagtagattcaaaaattgatcttgatgataatgctttttat
cgtcataaagatttggctgctcttagagatgagtctgaagaatctccattagaagtagaa
gcaagtcaatttggcttaaattacgtaaaacttgacggaaatgttgggtgtatggtaaat
ggtgctggtcttgcaatggctacaatggatatgattaaacttgctggtggtgagcctgct
aacttcctagacgttgggggtggggcatctgctgaaacagtagaaaaaggtttccgtatt
atcttgaaagatccaaatgtaaaagctattttaattaatatttttggtggtattgttcgt
tgtgacagagttgcaaacggagtagtagaagcctacaaaaatattggaaaaattgatgtg
ccaattatcgttcgtctgcaaggaacaaacgcagaagaaggagcagaaattattaaaggc
tctggattaaatgtaatttcagcaacagttttgaaagaagctgctgacagagtaaaagaa
gtattagccaactaa

DBGET integrated database retrieval system