KEGG   Finegoldia magna: FMG_0201Help
Entry
FMG_0201          CDS       T00661                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fma  Finegoldia magna
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FMG_0201
Enzymes [BR:fma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FMG_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237472..238935
Genome map
AA seq 487 aa AA seqDB search
MNDNRKAGILCPVFSLSSKYGIGSFGESAYKFVRFLKKSNQTYWQILPLVPISSDGNSPY
LSPSTFAGNYMYIDIDKLVDDGLLSESDVHGYKFEDDFVDYDYVAKSKNEILRKAFERNK
DLKIIDTQNFSERELVRGFCLFQALKKHFNGKSWLDFPDDIKYRKKKSVDYYENLLKDEI
EYNVFVQCVFYKQYFELKNYANDLGIKIFGDLPIYVSKESSDMWQNPDMFVVNEDLSPKL
VAGVPPDRFSETGQYWGNPVYDWNYCEKTGFDWWLKRLNHNLKMYDVIRLDHFRGFEAFW
AIDASKSTAENGHWVKAKGDEFFEILKKKNLIDRVVAEDLGLITDDVINLRDRFGFNGMK
VMQFAFDVNEESDYLPHNVGENCVYYTGTHDNQTLRGFVNSRSSDELEYIKNYVNSADVE
MSLIKVAYMTNSCLCICQMQDFLGLDDDYRTNTPNTLGNWTWRMKKDWLTDELAEKISEI
TKLYNRD
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatagaaaagcagggattttgtgtcctgtgttcagtttgagttctaaatat
ggaatcggaagttttggagagagtgcgtacaagtttgtgaggtttttgaagaaatcgaat
cagacttattggcagatattgccacttgttccgattagttctgatggaaacagcccgtat
ttgtcgccgtcaacttttgctggaaactacatgtacatcgacatcgacaagttggttgac
gatggtttgctgagtgagagtgatgttcatggctacaaattcgaagacgattttgtggat
tacgattatgttgcaaaatcaaagaatgagattctacgaaaagcatttgaacgtaacaag
gatttgaagataatcgacacgcaaaattttagtgagcgtgaacttgttcgtggattttgt
ttgtttcaggctttgaaaaagcattttaatggcaaatcttggttggattttccggatgat
ataaaataccgcaagaagaaaagcgtcgattattacgaaaatttgttaaaagatgagatt
gaatacaatgtgttcgtacaatgtgtgttttacaagcagtatttcgaattgaaaaattac
gcgaatgatttggggataaaaatatttggcgatttgccgatttatgtgtcgaaggaaagc
agcgatatgtggcaaaatccagatatgtttgtggtgaacgaggatttgtcgccgaaactt
gtcgcaggagttcctccggacagattttctgaaactgggcagtattggggaaatcctgtg
tatgattggaattattgtgaaaaaactggatttgattggtggttgaagaggttgaatcat
aatttgaaaatgtacgatgtgattcgtctggatcattttagaggatttgaagctttttgg
gcgattgatgcatcgaaaagcactgctgaaaatgggcactgggttaaggcaaaaggcgat
gagtttttcgagattttgaagaaaaagaacttgattgacagggttgttgccgaggatttg
ggcttgattactgatgatgttatcaatctgcgtgacagatttggtttcaatggcatgaag
gtgatgcaatttgcgtttgatgtgaacgaggagtcggattatttgccgcacaatgtggga
gaaaattgtgtttactacactggaactcacgacaatcaaacgttgaggggatttgtaaat
agcagaagttctgatgagcttgaatacattaaaaattatgtgaattcagctgatgttgaa
atgtctttgataaaggtagcgtacatgacaaattcttgtttgtgtatttgtcagatgcag
gatttcttgggacttgatgatgattacaggactaacactccgaatactttgggtaattgg
acgtggagaatgaaaaaagattggcttacagatgaacttgcagaaaaaatatctgagatt
acgaaactctacaacagggattag

DBGET integrated database retrieval system