KEGG   Finegoldia magna: FMG_0217Help
Entry
FMG_0217          CDS       T00661                                 

Definition
pyruvate/ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
fma  Finegoldia magna
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FMG_0217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_0217
   00020 Citrate cycle (TCA cycle)
    FMG_0217
   00620 Pyruvate metabolism
    FMG_0217
   00640 Propanoate metabolism
    FMG_0217
   00650 Butanoate metabolism
    FMG_0217
  Energy metabolism
   00680 Methane metabolism
    FMG_0217
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FMG_0217
Enzymes [BR:fma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FMG_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(256836..257981)
Genome map
AA seq 381 aa AA seqDB search
MRRFLSGNEAVAQGVRLSKPNVISAYPITPQTTVVEKLSEIVEQKQLDARFVHVESEHSA
LSCAIGASAIGARTFTATSSQGLLYMAECLPYAAGGKFPIVMVNANRSTALPWNIFGDQR
DSLSQLDSGWIQVYVEDAQEALDTVIEAYYIAEHKKVSTPVMINLDGFDLTHTYEPVDVP
ENCDVDKFLPKFETENKFDVNHPRNLGFSVGPSDNLEWKIRENKAVVDSLEIIEESREKF
KQIFNRDHGGVIDSYKVEDADYVLISIGSISGLIRSVVDELREQGEKVGYLKLRYIRPFP
TEKLRNELQNVKRIGVLEKDISFGHFGTVYTNVKSVTDIDSQNFVGGLGGRNITRDNIKE
IFEKLKQKGEELNFIGAKCNE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatttttatcgggaaacgaagctgtagcacaaggcgttagattatcgaaacca
aacgtaatttcggcgtatccaatcactccacaaactacagtggttgaaaaactatcggaa
atagtagaacaaaaacagctcgatgcaagatttgttcatgttgaaagtgaacactctgct
ctatcttgtgcaatcggtgcaagtgcaattggggcgagaactttcacagcgacaagttca
caaggactgttgtacatggcagaatgtcttccctacgctgctggcggcaaattccctatc
gtgatggtgaatgcgaatcgttcaactgcacttccttggaatatcttcggagaccaacgt
gattccttgtcgcaacttgatagcggttggattcaagtgtacgtggaagatgcacaagaa
gctttggacacagtaattgaagcgtattacatagctgaacacaagaaagtctccactcca
gtgatgattaacttggatggattcgacctcacacacacttatgaacctgtagatgttcca
gaaaactgtgatgtggataagttcttaccgaaatttgaaactgaaaacaaattcgacgtc
aatcatccgagaaatttggggttttcagtggggccaagtgataatttggaatggaaaatc
agagaaaataaagccgttgtggattctttggaaataatcgaagaatcaagagaaaaattc
aaacaaattttcaatagagatcacggtggtgtgattgattcctacaaagttgaagatgca
gattatgttttgatttctatcggatcaatctctggattaatcagaagtgtagtcgatgaa
ttaagagaacaaggtgaaaaagtcggatacttgaaactaagatacatcagaccttttcca
acagaaaaattgagaaacgaacttcaaaacgtgaaaagaattggggttttggaaaaagat
atttcgttcggacatttcggaactgtctacactaatgtaaaatcagtcacagacatcgat
tcacaaaatttcgttggaggacttggaggacgcaacatcacaagagataacatcaaagag
attttcgaaaaacttaaacaaaagggcgaagaacttaattttataggagcgaagtgcaat
gagtaa

DBGET integrated database retrieval system