KEGG   Finegoldia magna: FMG_0218Help
Entry
FMG_0218          CDS       T00661                                 

Definition
(GenBank) pyruvate/ferredoxin oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
fma  Finegoldia magna
Pathway
fma00010  Glycolysis / Gluconeogenesis
fma00020  Citrate cycle (TCA cycle)
fma00620  Pyruvate metabolism
fma00640  Propanoate metabolism
fma00650  Butanoate metabolism
fma00680  Methane metabolism
fma01100  Metabolic pathways
fma01120  Microbial metabolism in diverse environments
fma01130  Biosynthesis of antibiotics
fma01200  Carbon metabolism
Module
fma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_0218
   00020 Citrate cycle (TCA cycle)
    FMG_0218
   00620 Pyruvate metabolism
    FMG_0218
   00640 Propanoate metabolism
    FMG_0218
   00650 Butanoate metabolism
    FMG_0218
  Energy metabolism
   00680 Methane metabolism
    FMG_0218
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FMG_0218
Enzymes [BR:fma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FMG_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: BAG07636
UniProt: B0S026
Position
complement(258252..258788)
Genome map
AA seq 178 aa AA seqDB search
MIEITFRGRGGQGAFTASKIIGNACVKQANLYSLAFPTFGPERRGAPVSAFTKIDTKKIE
DRTQVQNPDYLVILDESLFNVNELKNLTDCTVFINSSKKFEEKNVISVDATKIALDILHK
PITNTAMIAALFSKFDVIDKQSIVESFKDNLSPSVVDKNVELFEEVLKEVNENEKARA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgattgagataacttttagaggaagaggaggacaaggagcattcactgcatctaaaata
attggaaatgcatgtgtgaaacaagccaacttgtactcgttggctttcccaacgtttggc
ccagaaagaagaggcgctcctgtgagtgcttttacaaaaatagatacgaaaaaaatcgaa
gacagaacacaagtacaaaatccagattatttggttatactcgacgaatcgctgttcaat
gtgaatgaattaaaaaatcttacagattgcacagtattcatcaattcttcaaaaaaattt
gaagaaaaaaatgtgatttctgtagatgcaaccaaaatcgctttggatattttacataag
ccgattacaaatactgcaatgatcgcagcactgttttccaaattcgatgtcatcgacaaa
caaagcatcgtagaaagtttcaaagataatttgtcgccatcagtcgtggataaaaacgta
gaattattcgaagaagttttgaaagaggtgaatgaaaatgaaaaggccagagcttaa

DBGET integrated database retrieval system