KEGG   Finegoldia magna: FMG_0486Help
Entry
FMG_0486          CDS       T00661                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fma  Finegoldia magna
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FMG_0486
   01230 Biosynthesis of amino acids
    FMG_0486
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_0486
   00030 Pentose phosphate pathway
    FMG_0486
   00051 Fructose and mannose metabolism
    FMG_0486
   00052 Galactose metabolism
    FMG_0486
  Energy metabolism
   00680 Methane metabolism
    FMG_0486
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FMG_0486
Enzymes [BR:fma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FMG_0486
Protein phosphatases and associated proteins [BR:fma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FMG_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546170..547297
Genome map
AA seq 375 aa AA seqDB search
MGFDNVYGALYGVQGLLDSKIIDLKSQIKTDKDLNRLKITPASALGSCRYKVDSEEKLAK
IVEILKSFNINYFIYIGGNDSMDTVYQLSKYIEKIGEDINVMGSPKTIDNDLFGTDHTPG
FGSAAKFVANSVYEIAKDVEIYDYRTITIVEIMGRYAGWLTAAGAISKKLCNLGADLVYI
SEDTFEFDNLVKEINENFKRTDNILILVSEGIKDSSNNFISKTSGKKDKFGHAQLQGPSH
IIRDKLKEIYDMPIRSIELNILQRCDMSFASKTDIEESFEVGEFSVECVENHSGKMVGIK
RISNKPYKTEFELVDIEKVANKTKMIVPKYTDSHFQIDDEFMDYILPLIEGEIEVEYKNG
IAQYFAFDKEDIVKL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgggatttgacaatgtgtacggagctttatacggagtacaaggattattggattccaaa
atcatagacttgaagtcgcaaatcaaaacagataaagatttgaacagattaaaaatcact
cctgcaagtgcattgggttcttgcagatacaaagtagatagcgaagagaaacttgccaaa
atcgtagaaattttgaaatcatttaatattaattattttatctacattggtggcaatgat
tcaatggacactgtgtatcaattatccaaatacatcgaaaaaattggagaagatattaat
gtaatgggatctccaaaaacaattgacaatgatttgtttggaacagatcacactccaggg
tttggttctgcagcaaaatttgtggcgaattctgtttatgaaatagcaaaggatgtcgaa
atctacgactatagaacgataactattgtagaaattatgggacgatacgctggatggtta
acagcagcaggagcaatctccaagaaactttgcaatcttggagcagatcttgtgtatata
agtgaagatacatttgaatttgataacctagtcaaggaaatcaatgaaaacttcaaaagg
acagataatattttgattttagtaagtgaaggtattaaagattcttcaaataacttcata
tccaaaacatctggcaagaaagacaagttcggccatgcacaattgcaaggaccatcgcac
ataatcagagataaattaaaagaaatttacgatatgccaattagaagtattgaactcaac
atacttcaacgatgtgatatgtcatttgcatccaagactgatatcgaagaatcattcgaa
gttggagaattttctgttgagtgtgtagaaaatcattcaggtaaaatggttggaatcaaa
agaatttccaacaaaccttacaagacagaatttgaacttgttgatatagaaaaagttgcc
aacaaaacaaaaatgatagttccaaaatacacagacagccatttccaaatcgacgacgaa
tttatggactacattcttcctttaatcgaaggagaaatcgaagtagaatacaaaaatgga
atagcacaatactttgcattcgacaaagaagatattgtgaaattgtaa

DBGET integrated database retrieval system