KEGG   Finegoldia magna: FMG_0509Help
Entry
FMG_0509          CDS       T00661                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
fma  Finegoldia magna
Pathway
fma00010  Glycolysis / Gluconeogenesis
fma00030  Pentose phosphate pathway
fma00051  Fructose and mannose metabolism
fma00680  Methane metabolism
fma01100  Metabolic pathways
fma01110  Biosynthesis of secondary metabolites
fma01120  Microbial metabolism in diverse environments
fma01130  Biosynthesis of antibiotics
fma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_0509
   00030 Pentose phosphate pathway
    FMG_0509
   00051 Fructose and mannose metabolism
    FMG_0509
  Energy metabolism
   00680 Methane metabolism
    FMG_0509
Enzymes [BR:fma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     FMG_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos FANCI_S1
Motif
Other DBs
NCBI-ProteinID: BAG07927
UniProt: B0S0K3
Position
complement(574894..576846)
Genome map
AA seq 650 aa AA seqDB search
MNNLKYLKLLAKEFPTIEQAANKIISLTSLSVLPKGTEYFLSDLHGQYDSFNRIIKSASG
NTRIKIDLEFKDKLSESRKNQLANLIYDPKTIINITKENDEYTETWIRDTIFYLIRIAKR
VASKYSRQKVRNQTPFYYRDLIDEMLNIQYESLNKKEYFNQLLDSIIKIEVSENFIITLC
ELIQDLNIDWLHIVGDIFDRGKRPDIIMDTLIAKKDVDIQYGNHDVTWIGAYLGSYVNAC
NVVRNAISYNNFQSLEDGYGINLRLLSTLADESYYDDPCERFKVRILDDNKHSETDLLHA
ARMHKAISIIQFKLENQLFKRNPEFEQLDRLYLERIDFKNGIYKDANGKAHALLDIKFPT
VDPDNPLELTPSEQEVVECISKSFRTSHRLKEHMDFLFSYGSVYKIANSNLLFHGCIPMN
KDGSFEEFTYQSNTYSGKSLLDFFEGIINSARNMDDNDPDRQTALDFFWYMWCGPKSPMF
GKSKISTFENFFITDKDVRKEVSNPYFSLSKIEKYADKIFEEFNMNPETSHIINGHVPVK
SINGEKPVSANGKTYVIDGGISEAYQKKTGIAGYTLTFNSHHLAIAKHKNFQVMESVHGA
YTPEVTITEEFPKRMLIKDTDEGEEILELIEDLESLIDAYRSGTIQQNSN
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaatttaaaatatttgaaattacttgcaaaagaatttcctacgattgaacaagct
gctaataaaataataagtttgacttctttgtcagtgttaccaaaaggcacggagtacttt
ttatcagatttacacggacaatatgatagcttcaatagaattataaaaagtgcttcaggt
aatactagaattaaaattgatcttgaattcaaagacaaattatcagaatcaagaaaaaat
cagttggccaatttaatttacgaccctaagacgattatcaatataacaaaggaaaacgat
gaatacacggaaacatggattagagataccattttttatttaataagaatagcaaaacga
gttgcgagcaaatattccagacaaaaagtcagaaaccagactcctttttattacagagat
ttgattgatgaaatgctcaacattcagtatgaatctttaaacaaaaaagaatattttaac
caacttttggatagtatcattaaaatagaagttagcgaaaattttataataactttgtgt
gaattaattcaggatttaaatatcgactggcttcacatagtgggagatattttcgacaga
ggaaaaaggccagacattattatggatacattaattgcaaaaaaagatgtggatattcaa
tacggaaaccatgatgtaacatggattggtgcatatcttggaagttatgtaaatgcatgc
aatgttgttagaaatgctataagttataataattttcaatctttggaagatggctacgga
attaatttgagattattgtctactttggcagatgaatcatactacgacgatccttgcgaa
agattcaaagttagaatcttggatgataataaacactcagaaacggatttgctacatgcc
gcaagaatgcacaaggctatttcaatcattcaattcaaattggagaaccaactttttaag
agaaatccagaattcgaacagttggacagattatatctagaaagaatcgactttaaaaat
ggaatttacaaggatgcaaatggtaaagctcatgcgcttttggatataaaattccctaca
gttgatcctgacaatcctctagagttaacaccaagtgaacaagaagttgtcgaatgcatt
tcaaaatcattcagaacaagtcacagattaaaagaacacatggactttttattctcctat
ggttctgtttacaaaatagcaaacagcaatttactttttcatggatgtattcctatgaac
aaggacggaagttttgaagaatttacgtatcaatctaacacatacagcggcaaatcgctt
ttggatttctttgaaggaattattaattcggcaagaaacatggatgacaatgatcctgac
agacaaactgcgttggactttttctggtacatgtggtgtggtccaaaatcaccaatgttc
ggaaaaagcaaaatatcaacatttgaaaacttcttcatcactgacaaagatgtcagaaaa
gaagtaagtaatccttatttcagtttaagtaaaattgaaaaatacgcagacaaaatattc
gaagaattcaatatgaatcctgaaacttctcacataattaacggccatgtcccagttaaa
agcatcaacggagaaaaaccagtgtctgctaatggcaaaacttatgtaattgatggtgga
atttccgaagcctaccaaaagaaaactggaattgctggttatacattgacatttaactcg
catcacttggcaatagcaaagcataagaattttcaagttatggaatcagttcatggtgca
tacacgccagaagttacaattacagaagaatttccaaaaagaatgctcataaaagataca
gatgaaggagaagaaatccttgagcttatcgaagatttggaaagtttaatcgatgcatat
agaagcggaacaattcaacaaaattcaaattaa

DBGET integrated database retrieval system