KEGG   Finegoldia magna: FMG_0514Help
Entry
FMG_0514          CDS       T00661                                 

Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
fma  Finegoldia magna
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FMG_0514
DNA repair and recombination proteins [BR:fma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FMG_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
581318..581926
Genome map
AA seq 202 aa AA seqDB search
MSLYPKAMDELIKNLSNLPTIGRKSARRLAYRIIDMDPKKVDELVESIVNVKTNIRPCAN
CGNLTDKKLCDICSDQKRDNSVITVVEDSMNVISIEKTGEYNGKYHVLGGLLSPRDNIAP
QDLNLENLFLRCKKDYVKEVILALSPTTNGDLTTNFIIEVLKNEEYNVKVSRIAMGVPLG
ANLEYYDEMSLYKAILDRREIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtcactataccctaaagcaatggacgaattgattaaaaatttgtccaatttgccaacc
attggcagaaaaagtgcgagaagattagcttatagaattatagacatggatcctaaaaaa
gtcgatgagcttgtagaaagcattgtaaatgtgaagactaacattagaccatgtgctaat
tgtggaaatcttactgataaaaaattatgtgatatttgttccgatcaaaaaagagataac
agtgtgataactgtcgttgaagattcaatgaatgtaatttcaattgaaaaaactggagaa
tacaacgggaaatatcacgttttaggaggattattatctccaagagataatatagctcca
caagatttgaatttggaaaatttgtttttgagatgcaaaaaagattatgtaaaggaagtt
atcctagcattatcaccaacaactaacggagatttaacaactaacttcatcatagaagtt
cttaaaaatgaagaatataacgtaaaagtttccagaattgcgatgggagtaccattggga
gctaatttggaatattatgacgaaatgagcttgtacaaagctattttggatagaagagaa
ataaaataa

DBGET integrated database retrieval system