KEGG   Finegoldia magna: FMG_0657Help
Entry
FMG_0657          CDS       T00661                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fma  Finegoldia magna
Pathway
fma00230  Purine metabolism
fma01100  Metabolic pathways
Module
fma_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FMG_0657
Enzymes [BR:fma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FMG_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_17 AAA_33 AAA_22 RsgA_GTPase MMR_HSR1 AAA_14 AAA_16 RNA_helicase Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: BAG08075
UniProt: B0S135
Position
721260..721847
Genome map
AA seq 195 aa AA seqDB search
MRDGFLLVVSGPSGVGKGTVCEKLISQKKDIVYSVSATTRKKRPYEVDGENYYFLSLDEF
KKKIDQGDFIEYANVHNNYYGTPKSFVFDQINKGEIVILEIDVQGALKVKENYPEAVFVF
ILPPDLIELRRRIEGRNTEDEETINIRMQNAKKELSFIDEYDYAVINEDVDETVKNIETI
IDAEKFRVVKGEKYD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagagacggatttttattagttgtttctggtccatcgggagttggcaaaggaactgtt
tgtgaaaaattaatatcacagaaaaaagatattgtatattctgtatccgctacgacaaga
aaaaagagaccttatgaagtagacggagaaaattattattttttgagtttagatgagttt
aagaaaaaaattgatcaaggagatttcattgaatatgctaatgtacacaataattattat
ggaactccaaaatcatttgtcttcgaccaaatcaataaaggagagatagttattttagaa
attgatgttcaaggagcattaaaagtaaaagaaaactatccagaagctgtttttgtattc
attcttccaccagatttaattgaacttagaagaagaattgaaggaagaaacactgaagat
gaggaaacaattaatattagaatgcaaaacgctaaaaaagaattgagttttattgatgaa
tatgattatgcagttattaatgaagatgttgatgaaactgtaaaaaatattgaaactata
attgatgcagaaaaatttagagttgtaaaaggagaaaaatatgattaa

DBGET integrated database retrieval system