KEGG   Finegoldia magna: FMG_0720Help
Entry
FMG_0720          CDS       T00661                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fma  Finegoldia magna
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fma00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782601..783521
Genome map
AA seq 306 aa AA seqDB search
MLKNRNLINADDFNVEEINEILNLAEEIIKSPSDFSNLCNGKILGTLFFEPSTRTRLSFE
SAIHRLGGDCIGFSESASSSTSKGESLADTIRTVSNYTDIIAMRNPKEGSAVLASSYAEV
PLINAGDGGHQHPTQTLTDLLTIWMTKKKLDNMTIGLCGDLKFGRTVHSLIKAMSRYENN
KFILISPEELQVPDYIKMFLKSKNIEFKEVEKMEDVIGELDVLYMTRVQKERFFNEADYV
RLKDSYILDNDKMKLATEDLAVLHPLPRVNEIATEVDSDPRAVYFKQVRYGVIVRMALIL
KLLGVR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaatagaaatttaattaacgcggatgattttaatgtagaagagataaacgaa
atattaaatttagcagaagaaattataaagagtccttctgatttttctaatttatgtaat
ggaaaaatcttagggactcttttttttgagccttcaacaagaactagattaagttttgag
tcagcaatacatagattaggcggtgattgcataggattttccgaaagcgcaagttcatct
acatcaaagggtgaatctttggctgatacaataagaactgtatcgaattatacagatata
atagcaatgagaaacccaaaagaaggttcagcagtattagctagttcatatgcagaagtt
ccattgataaatgcaggagatggcggacatcaacatcccactcaaacattgacagacttg
ctaacaatttggatgacaaagaaaaaattagacaatatgactataggattgtgtggggat
ttgaaatttggtagaacagtgcattctttaataaaagctatgtcaagatatgaaaacaac
aaattcatattaatttcaccagaagaacttcaagtaccagattatattaaaatgttttta
aaatctaaaaatatagaattcaaagaggttgaaaaaatggaagacgtaatcggagagctt
gatgttttatatatgacaagagttcaaaaagaaagattctttaatgaagcagattatgtt
agattaaaagattcatatattttagataatgataaaatgaaattagcaactgaagactta
gctgtacttcatccgttgccaagagtgaatgaaatagctactgaagttgatagcgatcca
agggccgtttatttcaaacaagttagatacggcgtaattgttagaatggcattaatatta
aaattattaggggtgagataa

DBGET integrated database retrieval system