KEGG   Finegoldia magna: FMG_0720Help
Entry
FMG_0720          CDS       T00661                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fma  Finegoldia magna
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FMG_0720
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FMG_0720
Enzymes [BR:fma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     FMG_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782601..783521
Genome map
AA seq 306 aa AA seqDB search
MLKNRNLINADDFNVEEINEILNLAEEIIKSPSDFSNLCNGKILGTLFFEPSTRTRLSFE
SAIHRLGGDCIGFSESASSSTSKGESLADTIRTVSNYTDIIAMRNPKEGSAVLASSYAEV
PLINAGDGGHQHPTQTLTDLLTIWMTKKKLDNMTIGLCGDLKFGRTVHSLIKAMSRYENN
KFILISPEELQVPDYIKMFLKSKNIEFKEVEKMEDVIGELDVLYMTRVQKERFFNEADYV
RLKDSYILDNDKMKLATEDLAVLHPLPRVNEIATEVDSDPRAVYFKQVRYGVIVRMALIL
KLLGVR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaatagaaatttaattaacgcggatgattttaatgtagaagagataaacgaa
atattaaatttagcagaagaaattataaagagtccttctgatttttctaatttatgtaat
ggaaaaatcttagggactcttttttttgagccttcaacaagaactagattaagttttgag
tcagcaatacatagattaggcggtgattgcataggattttccgaaagcgcaagttcatct
acatcaaagggtgaatctttggctgatacaataagaactgtatcgaattatacagatata
atagcaatgagaaacccaaaagaaggttcagcagtattagctagttcatatgcagaagtt
ccattgataaatgcaggagatggcggacatcaacatcccactcaaacattgacagacttg
ctaacaatttggatgacaaagaaaaaattagacaatatgactataggattgtgtggggat
ttgaaatttggtagaacagtgcattctttaataaaagctatgtcaagatatgaaaacaac
aaattcatattaatttcaccagaagaacttcaagtaccagattatattaaaatgttttta
aaatctaaaaatatagaattcaaagaggttgaaaaaatggaagacgtaatcggagagctt
gatgttttatatatgacaagagttcaaaaagaaagattctttaatgaagcagattatgtt
agattaaaagattcatatattttagataatgataaaatgaaattagcaactgaagactta
gctgtacttcatccgttgccaagagtgaatgaaatagctactgaagttgatagcgatcca
agggccgtttatttcaaacaagttagatacggcgtaattgttagaatggcattaatatta
aaattattaggggtgagataa

DBGET integrated database retrieval system