KEGG   Finegoldia magna: FMG_0791Help
Entry
FMG_0791          CDS       T00661                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fma  Finegoldia magna
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FMG_0791
   01230 Biosynthesis of amino acids
    FMG_0791
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_0791
   00051 Fructose and mannose metabolism
    FMG_0791
   00562 Inositol phosphate metabolism
    FMG_0791
Enzymes [BR:fma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FMG_0791
Exosome [BR:fma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FMG_0791
  Exosomal proteins of bladder cancer cells
   FMG_0791
  Exosomal proteins of melanoma cells
   FMG_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857658..858413)
Genome map
AA seq 251 aa AA seqDB search
MRKPLIAGNWKMNKTDGETKQFINDLKCLDISDNVEACIISPFTSLKTLTEDLRNSNIST
GAQNMYYEECGAFTGEVSPNMLKDLGIDYVIIGHSERRTIFKEDDELLNKKIASALKHDI
KPILCCGENLEQRESNRHEEVVESQIRLDLKGINEKDIMSKLVIAYEPIWAIGTGKTASS
DDAQSMCKFIRNLLSKMYSKDLADSVRIQYGGSVKPENILDIMSKEDIDGALVGGASLEA
ESFSKLINYGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctttaattgcaggaaattggaaaatgaacaagactgacggagaaactaag
cagtttataaatgatttaaaatgtttagatatttctgataatgttgaagcttgtattata
tctccattcacgtctttaaaaacacttactgaagatttaagaaattcaaatatttctaca
ggcgcacaaaatatgtattatgaagaatgtggtgcttttactggagaagtttctccaaat
atgcttaaagatttgggcattgactatgttataattggtcattctgaaagaagaaccata
tttaaagaagatgacgaattattaaataaaaaaatagcatctgcattaaaacacgatatt
aaaccaatactttgttgcggagaaaatttagaacaaagagaatccaatagacacgaagag
gtagttgaatcacaaatcagattagacttgaaagggataaatgagaaggacataatgtcc
aaattagtcattgcttatgaacctatatgggctattggaactggaaagacagcttctagt
gatgatgctcaatctatgtgtaaatttatcaggaatttattgtcgaaaatgtatagcaaa
gatttagcagattcagttaggatacaatatggtggaagtgtaaaacctgaaaatatattg
gacataatgtcaaaagaggacattgatggagctttagtagggggtgcaagtttagaagct
gaaagtttttctaaacttattaattatggaaaataa

DBGET integrated database retrieval system