KEGG   Finegoldia magna: FMG_1002Help
Entry
FMG_1002          CDS       T00661                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fma  Finegoldia magna
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FMG_1002
   01230 Biosynthesis of amino acids
    FMG_1002
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_1002
   00030 Pentose phosphate pathway
    FMG_1002
   00051 Fructose and mannose metabolism
    FMG_1002
   00052 Galactose metabolism
    FMG_1002
  Energy metabolism
   00680 Methane metabolism
    FMG_1002
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FMG_1002
Enzymes [BR:fma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FMG_1002
Protein phosphatases and associated proteins [BR:fma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FMG_1002
Messenger RNA biogenesis [BR:fma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FMG_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1086044..1087003)
Genome map
AA seq 319 aa AA seqDB search
MKTIAILTSGGDAPGMNACIRSIARTCIYNGIRVMGIRSGYDGLMNGNIYEMNVSSVADI
IHRGGTILGSARCPEFKTEEGQKKGAQILKDFGIDGLVVLGGDGSFKGASALSKIGISTI
GIPCTIDNDMGYTDYTIGFFTAVETVSDAISKLRDTSSSHGRANIIEVMGRNCGDIALYS
GVASGAESILVPEVELNIDEVTEKIERGRKRGKLHHLIMLAEGVGGAYDIKNMIEEKTGV
ETKVTILGHVQRGGTPCTFDRLMATQMGNLAVKLIMEEKTDLAIAMKDNKIITVPIDEAV
TTKRKFRDDLYEISKEISI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagcaattctaacaagtggtggcgatgcaccaggaatgaatgcatgcatt
cgttctatagctagaacttgtatttacaatggtataagagttatgggaataaggtctgga
tatgatgggcttatgaacggaaatatttacgaaatgaatgtttcttctgttgcagatatt
attcaccgtggcggaactatcttgggatctgcgagatgcccggaattcaaaaccgaagaa
ggtcaaaaaaagggtgcacaaattttaaaagattttggaatagatggacttgtggtttta
ggtggagatggttcatttaaaggtgcaagtgcacttagcaaaataggaatatcgactatt
gggattccttgtacaatagataatgatatgggttataccgattatacgattggatttttc
actgctgttgagacagtaagtgatgcgatatcaaaattaagagacacttcttcaagccat
ggacgagcgaacataattgaagttatgggaagaaattgcggagatatcgcattgtattca
ggagttgcatcgggagcggaatctattctcgttcctgaagtagaattaaatatagatgag
gttacagaaaaaatcgaacgaggaagaaaaagaggaaaacttcatcatttaattatgctt
gctgaaggagtcggtggagcatatgatattaaaaatatgattgaagaaaaaactggagta
gaaacaaaagttacaattttgggtcacgttcaacgtggtggaactccatgtacatttgat
aggttaatggcaacacaaatgggaaatttggcagtaaaattaataatggaagaaaaaaca
gacttggctatcgccatgaaagataataagataatcacagtcccaattgatgaggcagtt
acaacaaaaagaaaatttagagatgatttgtatgaaatatccaaagaaatctcaatataa

DBGET integrated database retrieval system