KEGG   Finegoldia magna: FMG_1039Help
Entry
FMG_1039          CDS       T00661                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fma  Finegoldia magna
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FMG_1039
Enzymes [BR:fma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FMG_1039
Exosome [BR:fma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FMG_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1128413..1130317)
Genome map
AA seq 634 aa AA seqDB search
MEKYFYHGKNETDVYLFHEGNNNNLYKFLGSHIYTDDIGTYTRFLVWAPNAKNVNLVGDF
NNWNDYSLPLRKLQDGEIWEICIRNVKIFDSYKYRIVTQDSDVLYKADPFAFHSELRPKT
ASKVYDIEGYKWNDKKWLKKREKTDKFNSPMSIYEINLSSWRKHGENYLSYVQLSDELVA
YLKEMNYTHVEFMPLMEHPFDGSWGYQLTGFFAATSRFGCPKDLMYLIDKLHQNDIGVIM
DWVPAHFCKDDFGLRKFDGSNLFEKTDQYLADNDQWGTLNFDFSKKEVVNFLISSALFWF
KYYHLDGLRVDAVAYMIYLNFSGKDIRNEDGGYENKEAIEFIKKLNNTIKQEFPSVFVIA
EESTAWPNVTKPVKENGLGFDFKWNMGWMNDIIKYMKMDPLFRKDHHNLLTFSIMYAFNE
NYILPFSHDEVVHMKNSMIGKMPGTYDQKFDQIRLLYSFMFAHPGKKLLFMGNDIGQFDE
WNEYKEITWEVLEYEKHQKLKYFMKDLNKFYLNNDEFYDLDTSYSGFQWEDVNNTNESLI
IFERINSKNEKIFCIFNFTPVRRKKYPVGVDEYALYSVVLNSSMKKYGGSLLRNKPYYSK
NKEHNDRKFSITVDIEPFSAMFIKLNKLRCINKN
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatttttatcatggaaaaaatgaaacagatgtttatttatttcatgaagga
aacaacaataatttgtataaatttttaggatcacatatttatacggatgatattgggacc
tacaccagatttttggtgtgggctcctaatgcaaaaaatgtaaatttggttggagatttc
aataattggaacgactattcacttccgcttagaaaattacaagatggagaaatttgggag
atatgcattagaaatgtaaaaatatttgattcatataagtacagaatagtcactcaggat
tcagatgttttgtataaagctgatccttttgcatttcatagcgaattaagaccgaaaact
gctagcaaagtttatgatattgaaggctataaatggaatgataaaaagtggcttaaaaaa
agagaaaaaacagataaatttaatagtcctatgagtatctatgagataaatctttcttca
tggagaaaacatggtgaaaattatctgtcttatgttcaactatcagatgaattggtagct
tatctcaaagaaatgaattacactcatgttgagtttatgccattaatggagcatcctttt
gatggctcgtggggatatcaacttacgggattttttgcagcgacttctaggtttggatgt
ccaaaagatttgatgtatttgattgacaaattacaccaaaacgacattggagttatcatg
gattgggttccagctcatttttgcaaagatgattttggccttagaaaatttgacggaagt
aatttattcgaaaaaacagatcaatatttagctgacaacgatcaatggggaacgttgaac
tttgacttttcaaaaaaagaagttgtaaatttccttatatcttctgcgttattttggttc
aagtactatcacttggatgggctaagagttgacgcagtggcttatatgatttacttaaat
ttctctggaaaagacatccgtaacgaagatggtggatacgaaaacaaagaggcaattgaa
tttatcaaaaaattaaataatacaattaaacaagagttccctagtgtttttgtcattgcg
gaagaatcgactgcttggccaaatgtaacaaagccagtaaaagaaaatggtcttggtttt
gattttaagtggaatatgggttggatgaatgatatcataaaatacatgaaaatggatcct
ctgtttagaaaagatcaccataacttactaactttttcgataatgtatgcatttaatgaa
aattacattttgccatttagccatgatgaagttgttcatatgaaaaactcgatgattgga
aaaatgccaggaacttacgatcagaaatttgatcaaataagacttttgtattcgttcatg
tttgcacatcctggtaagaaacttttgtttatgggtaatgatataggccaatttgatgag
tggaatgagtataaagaaatcacatgggaagttttggaatacgaaaaacatcaaaaactt
aaatatttcatgaaagatttgaataaattctacttaaataatgatgaattttatgatttg
gatacaagctattctggttttcaatgggaagatgtgaataatacaaatgaatctttgata
atttttgagagaattaattctaaaaatgaaaaaattttttgcatttttaatttcacacca
gttagaagaaaaaaatatccagtaggagtagacgaatatgcactatattcagttgtactt
aattcttcgatgaaaaaatacggtggaagtttactaagaaataaaccttattattcaaaa
aataaagaacataacgacagaaaattttctattacggttgatatagaaccattttctgca
atgtttattaaattgaacaaacttagatgtatcaataaaaattag

DBGET integrated database retrieval system