KEGG   Finegoldia magna: FMG_1511Help
Entry
FMG_1511          CDS       T00661                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fma  Finegoldia magna
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FMG_1511
   00052 Galactose metabolism
    FMG_1511
   00500 Starch and sucrose metabolism
    FMG_1511
   00520 Amino sugar and nucleotide sugar metabolism
    FMG_1511
Enzymes [BR:fma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FMG_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669492..1670355)
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVIPAAGFGTRMLPASKSVPKEMLPIYDKPTLHHIVKEVVDSGITDILIIISKDK
GSIEDYFDVNFELEYELNKKSSEISGEIHELSKMANIYTIRQKKKNGLGDAIKYAESFVG
DEPFAILLGDDIIYNTSDELPCIKQMADIYEREESPILGVQEVSWEDVDKYGIVNGVKTS
DRITEVESLVEKPSREEATTNLAILGRYIVTPDIFPILHETKPGKNNEIQLTDALNKLAE
KRKMIAYDFIGKRYDVGNKLGFVKATVDFALHDEKIKDELLEFLREK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagaaaagcggttattcctgcggcgggttttggtacgaggatgcttcctgca
tcgaaatctgttccgaaggaaatgcttccaatctacgataaaccaactttgcatcatatt
gtaaaggaggttgtggattctggaattacggatattttgattattataagcaaggataag
ggatctatcgaggattattttgatgtgaatttcgaattggaatacgaattgaacaagaag
tcttcggagatatcaggagaaattcacgagctttcgaagatggcgaacatctacacgatt
aggcagaaaaagaaaaacgggcttggcgatgcgataaaatacgcagaaagttttgttggt
gatgagccttttgcgattttgttgggagatgatattatttacaatacttctgatgaactt
ccttgcatcaaacaaatggctgatatttacgagagggaagaatcaccgattttgggtgtg
caagaagtttcgtgggaagatgtagacaagtacgggattgtgaatggtgtgaagacttcg
gatagaattactgaggttgagtcgttggtggaaaaaccaagccgtgaagaggctacaact
aacttggcaattcttggaagatacattgtaacgccggatatttttccgattcttcatgaa
acgaaacccggcaagaacaatgaaattcaattgactgatgctttgaacaagcttgcagaa
aaacgcaagatgattgcgtatgattttattggcaagagatacgatgtcggtaacaagctt
gggtttgtgaaggctacggttgattttgcactacatgatgagaaaataaaggacgaattg
ttggaatttttacgagaaaaataa

DBGET integrated database retrieval system