KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0125Help
Entry
OOM_0125          CDS       T02112                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OOM_0125
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     OOM_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118643..119470
Genome map
AA seq 275 aa AA seqDB search
MANIKPRNYQSYAKINLFLHILNKRDDGYHNLQTWFTFLDLKEHLSFRFNNSSKIEITSN
IQIASKEDNLIYKAVKEFQKAYKIDSVGVDIDIIKNIPMGAGLGGGSSNAAITLIALRDY
YLPELSNEQLIPLATKLGADVPIFVYGRSAWAEGIGEILYPKHFEPQYVLLVKPNIHIST
KEFFESESLAKTKNMLPRDLSFDTNVMHNDFENVFFAKYPEFKSLLDEIDQDFRMTGTGS
CFYLLSKDLNKLQQLARKVDKSLDKWVVKTLNCTY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataaaacctaggaactatcaaagttatgcaaaaattaatttgtttttgcat
atattgaataagcgagacgatggatatcataatttacaaacttggtttactttcttggat
ctaaaagagcatcttagctttagatttaataactctagtaagattgaaatcacaagtaat
atacagatagcctcaaaagaagataatctaatctataaagctgtcaaagagtttcaaaaa
gcctataaaatagatagtgttggtgttgatattgatattatcaaaaatataccaatgggt
gctggtcttggcggaggaagctcaaatgctgcaataaccttaatagcattacgtgattat
tacttaccagaactatcaaacgagcaactaataccattagctacgaagcttggagcagat
gtgccgatatttgtatatggtaggtcagcatgggctgaaggaattggggagattttatat
cctaagcattttgaaccgcaatatgtattgttagttaaacctaatattcatattagtact
aaagagttctttgagagcgaaagtttagccaagacaaagaatatgctaccgagagattta
agttttgatactaatgttatgcataatgattttgaaaatgttttttttgcaaaatatcct
gaatttaaaagcctgttagatgagattgatcaggactttagaatgacaggtacaggctca
tgcttttatctactttctaaagatcttaataaactacaacaacttgcaagaaaagttgat
aaatctcttgacaaatgggtagtcaaaacattaaactgtacgtactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system