KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0187Help
Entry
OOM_0187          CDS       T02112                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OOM_0187
   00240 Pyrimidine metabolism
    OOM_0187
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OOM_0187
   03430 Mismatch repair
    OOM_0187
   03440 Homologous recombination
    OOM_0187
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     OOM_0187
DNA replication proteins [BR:fna03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     OOM_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180663..181100
Genome map
AA seq 145 aa AA seqDB search
MKVEFRVLQTPDINQMLKVLIATIIKEYSERKTIAVLAPTGIAKQLDNDLWQDGQDSFIP
HHCAIAAREYNQYKNILILITDNLFITSGYDVLINIMEVVVDPQRVKIKELKEFVYQEER
ALQASRKKYVYYKNSNLEITTTKES
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagagtttagagttttacaaacgccagatattaaccaaatgctaaaagtgttg
attgctacaattatcaaagagtatagcgagcgcaaaacaatagcagttcttgctcctaca
ggtattgcaaaacaacttgataatgatttgtggcaagatggtcaagattcttttataccg
catcattgtgctatagctgctagagaatataatcaatataaaaatattctgattcttatc
acagataatttatttatcacttcaggttatgatgttttgattaatattatggaagtagta
gttgatcctcaacgagtaaaaatcaaagagttaaaagagtttgtttatcaggaagaaaga
gctttgcaggcttcgcgtaagaagtatgtttactataagaactcaaatttagaaataact
actaccaaagagagttag

DBGET integrated database retrieval system