KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0196Help
Entry
OOM_0196          CDS       T02112                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OOM_0196
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OOM_0196
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     OOM_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188192..188410
Genome map
AA seq 72 aa AA seqDB search
MIKVINKLSKNMQRKDLLKIVKRVVIKVGTSTLTHQTGLLNINRIEKLVRQLADLHNQGY
EVILVTSEAVGA
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtgataaataaattatcaaaaaatatgcaaagaaaagatctgctaaaaata
gtaaagagagttgttataaaagttggtactagcactttaactcaccaaacaggcttgtta
aatattaatcgtatagagaaacttgttagacagctagcagaccttcataatcaaggctat
gaagtaatactcgtaacatcagaagctgttggcgcttaa

DBGET integrated database retrieval system