KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0433Help
Entry
OOM_0433          CDS       T02112                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OOM_0433
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OOM_0433
Enzymes [BR:fna01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     OOM_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
398407..399711
Genome map
AA seq 434 aa AA seqDB search
MKAVRVKKLNKIADEVTINISGAKNALLHLIFAALIPDTKTKFSNVPTTLLDYKGAKEIL
ENVGANVVEKGESVTIDTSSISNEPLELCGEMTSKTRCSLMLLGSMLKKKGRVRIGFPGG
CSFSEKRPFDIHLNGLEALGAEVKLADDYIDVIYKEEKDAEFKMPFPSVGATMNLVMYAV
IGSSEVVLENVALEPEVVTLIDYLNQSGANIYFDTDSRKIRVIGISRLSGCKFEIIFDRI
QAMTYAAMAYLYKTNVTITNINTPDTYSIEKPLEKLISIGAKWEYNQSSRSIKFFGKDSS
IKGDDIIAAPFPHFPTDLQPIYAVMLFMANSSSTIQDTVYPERINYVYQIRKMGFNISID
NNLIKINPINDLRNIRSAVMSVKDLRAGMACLMAGSLLNEFSTINNAHQIFRGYNNLIEN
MSHFMHIEILDDNI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtaagagtaaaaaaactaaataaaattgctgatgaagtaacgattaatatt
agtggtgcaaaaaatgctcttctgcatttgatctttgcagctttgattcctgatactaaa
accaaattctctaatgtacccacaactcttttggactataaaggagctaaagaaatatta
gaaaatgttggcgcaaatgttgttgagaaaggcgagagtgtaactattgatactagttct
atctcaaatgagcctttagagctttgtggtgagatgacatctaaaactagatgttcatta
atgttgttaggctctatgctgaagaaaaaaggccgtgtaaggattggtttccctgggggg
tgtagctttagtgagaagcgaccgtttgatatacatcttaatggattagaggctctagga
gccgaggttaaattagctgatgattatatagatgttatctataaagaagaaaaagatgct
gagtttaagatgccttttccttctgtcggagcaactatgaacttagttatgtatgctgtc
ataggtagttcagaagttgtacttgagaatgttgcattagagccagaagttgttacttta
attgattatctaaatcagagtggtgctaatatttattttgatactgatagtagaaaaatt
agagttataggtatatcgagattatcagggtgtaaatttgagataatctttgatcgaatc
caagctatgacttatgctgctatggcatatctgtacaaaacaaatgttacaatcaccaat
atcaatactcctgatacttatagtatagaaaaacctcttgagaagcttattagtatagga
gctaagtgggagtataatcagtctagtcgtagtattaagttttttggtaaagatagttct
ataaaaggtgatgatataatcgcagctccttttccgcactttcctaccgatttacagcca
atatatgcagttatgctatttatggcaaatagttcaagtactattcaggatactgtatat
cctgagcgaattaattatgtgtatcaaattcgtaagatgggttttaatatttcaatagac
aataatctaataaagattaatcctattaatgatttgagaaatatacgttctgctgtaatg
agtgtcaaagacttgcgtgcgggcatggcttgtttgatggcaggttcgttgttgaatgag
ttttcaactattaataatgctcatcaaatttttagagggtataataaccttatagaaaat
atgtctcattttatgcatattgagattttagatgataatatttag

DBGET integrated database retrieval system