KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0443Help
Entry
OOM_0443          CDS       T02112                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OOM_0443
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_0443
   00052 Galactose metabolism
    OOM_0443
   00500 Starch and sucrose metabolism
    OOM_0443
   00520 Amino sugar and nucleotide sugar metabolism
    OOM_0443
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OOM_0443
   00524 Butirosin and neomycin biosynthesis
    OOM_0443
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OOM_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406697..407719
Genome map
AA seq 340 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLEDGLTQSIAIRKYKGANFNCLSDIIDKFLLEVDLVGQIDS
VCLAVAGFVANGEVQVTNLPWLVSEQYISEGLGIDKSKVKVINDFEAIGYGIESLDREKD
LITLQDGKKDDKTLCAVVGAGTGLGMCLVSYDKDHNPRVYKTEGGHVDFSPVDDEQIQLF
RFMRRTFHRISPERFCSGYGIFNIYKYVVRNPLYDQLECQSLRRELFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALSSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSSMMKDFPVHIIMNTDVGLIGARTYAAGLVKVE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatctggagatatcggtggaactaatactaggttagaggtttctcttcta
gaagatggtttaacacagagcattgctattagaaaatataaaggagcgaactttaattgt
ttgtctgatattattgataagtttttactagaagttgatctagtggggcagattgattct
gtgtgtcttgctgttgctggatttgtcgcaaatggagaagttcaagtaacaaatttgcca
tggttagtctcagagcagtatatctcagaaggtcttgggatagataaaagtaaagtcaaa
gttataaatgactttgaagctataggttatggtatagaatctttagatagagaaaaagat
ctcattacccttcaagacggtaaaaaagatgataaaacattatgtgctgtggtcggtgct
ggtacaggcctaggtatgtgtctagttagttatgataaagatcataatcctagagtgtac
aaaacagaaggtggtcatgttgacttttcaccagttgatgatgagcaaattcaactcttt
agatttatgcgtagaacttttcatcgtatatcaccagagagattttgcagtggctatggc
attttcaatatatataagtatgttgtacgtaatcctttatatgatcagctagagtgtcaa
tcactacgaagagaattatttagcgtatcagattctgataaagcagcagttattgttaag
tatgccatagagcatagagaaccctctgcgttgagaactatagatatatttttaagtata
tatggatcagtggcaggtaatttagcattatcaagtttaccttttagagggttgtacatt
gcgggaggtattgcacctagacttattaaacaaatcaaagaaagtaagtttttagagaag
tttagagataaaggtagaatgtctagtatgatgaaagatttccctgttcatataattatg
aatacggatgtcggtctaattggtgcgcgtacctatgcggcgggattagttaaagtagag
taa

DBGET integrated database retrieval system