KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0501Help
Entry
OOM_0501          CDS       T02112                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467888..468508
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAKIMADIPREIFLPKEYQSLAYCDTNLVIDDRELR
SPMFTARLIEALALKKTDNVLKLGLETGYPVALIAKLCNSVELVDYDEQRLAIARRNLAK
IDVYNVEFNSAEHLTNIIKNAKKYNRIYISNVVEENEVDESLLDLLEVGGRLVFVVRTNV
CDKAHLITKAVKETYQKNFLFNVYNR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagagaatatggtaaagcaacaagtcctcacagaaggtctt
tctttagatggtgttgcaaagattatggcagatatccctagagagatttttctacccaaa
gaatatcaatctttagcttattgtgatactaatcttgtgatagatgatagagaacttaga
agccctatgtttacagctaggctaatagaagctttagccctgaaaaaaactgataatgta
ttaaagcttggtttggaaacggggtatccagtagctttgatagcaaagctatgtaatagt
gttgaacttgttgattatgatgaacaaagattagctatagcaagacgtaatttagcaaaa
atagatgtctataatgtcgagtttaatagtgctgagcatctgacaaatattataaaaaat
gctaaaaaatataaccgcatatatatatcaaatgttgtagaagaaaatgaagtagatgag
tctttactagatcttcttgaagttggtggtagattggtttttgttgtcaggactaatgtg
tgtgacaaagcccatctcataactaaagcagtaaaagaaacatatcagaagaattttctc
tttaatgtttacaatagataa

DBGET integrated database retrieval system