KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0568Help
Entry
OOM_0568          CDS       T02112                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OOM_0568
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OOM_0568
   00650 Butanoate metabolism
    OOM_0568
  Energy metabolism
   00190 Oxidative phosphorylation
    OOM_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544330..544722
Genome map
AA seq 130 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVVIAVYFGYLILQTLCLSHAGGLNYDSWRGLFTDSMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKCAWASALIMLSFVLVYAFCFFWLFCGFIFLLRG
YFYEYSYARI
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatatcattaacttcttctggaattaaagacttttttgtacagagagtgaca
gctgtagttattgctgtttattttggttatcttattcttcagactttgtgcttatctcat
gctggagggcttaactatgatagctggagaggattgttcacagatagtatgttttttaga
gttgctacattgatggcttatttggcgatgttttttcatgcttgggtaggtatttggatt
atttgtggtgactatattaagtgtgcttgggcatcagctcttattatgttgagctttgta
ttagtctatgcattctgctttttttggttattttgcggttttatttttctactaagaggt
tatttttatgagtatagctacgcaagaatttga

DBGET integrated database retrieval system