KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0572Help
Entry
OOM_0572          CDS       T02112                                 

Definition
2-oxoglutarate dehydrogenase complex, E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:fna01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fna00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fna00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
550070..551527
Genome map
AA seq 485 aa AA seqDB search
MIELKVPMFPESVADGTLAQWNKSEGDFVEEGDIIVEIETDKVVMEVPATASGILKGIKK
QEGDIVLSEEFLANIDTNASASEPKQEVVAEVSSQASGKEVDVKAPVFPESVADGTVSEW
HKQEGDAVAEGDILAEIETDKVVMEVPATSNGVLSKILKPAGETVLSSELIAKVIEGAVA
SAAPKSETKAQEDKGNDPHLVPSARKAFNASGLDSAVSIEGTGKKGRITSEDVKKAVSSS
KTQQPTIVANQGPRYEKRVKMTRLRQTIANRLVEVQHTNAILTTFNEVDMSAVMALRNKY
KDIFLKEHDIKLGFMSFFIKAATEALKKFPDVNASIDGDEIVYHNYFDIGIAVGTDRGLV
VPILRDIDGKSLAELEADVLDKAIKGRDGKLSLEDMQGGTFTITNGGTYGSMLSTPIINS
PQSAILGMHNIVERPVVVNGEIKIRPIMYLALSYDHRIIDGGTSVRFLKMIKELLEDPNR
ILLQV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgattgaattaaaagtacctatgtttccagagtctgtcgcagatggcacattagctcag
tggaataaaagtgaaggtgattttgttgaagaaggcgatataattgttgaaatcgaaact
gataaagtggttatggaagttccagccactgccagcggtattctaaagggaatcaaaaag
caagaaggtgatatagtcttgtctgaagaatttttagcaaatattgatactaatgcttca
gcttctgagccaaagcaagaggttgttgcggaggtttcttcacaagcttctggcaaagaa
gtagatgttaaagcacctgttttcccagagtctgttgcagatggtacagtttctgagtgg
cataagcaagaaggtgatgctgtagcagaaggcgatattttagctgagatcgaaacagac
aaagtggtcatggaagttccagcgacatctaatggagttttatcaaaaatattaaaacct
gctggtgaaacagttctttcatcagagctaatagcaaaagttattgaaggcgcagtggca
tctgcagcacctaagtcagaaacaaaagcccaggaagataaaggtaatgatcctcattta
gttccttctgcacgtaaagcatttaatgcaagtggattagattctgctgtaagtattgaa
ggtactggtaagaaaggacgtataacatctgaggatgttaaaaaagcggtatctagtagc
aagacacaacagcctactatagtcgctaaccaaggtccaagatacgaaaaaagagttaag
atgactcgtttacgtcaaactattgcaaatagattagttgaggttcagcatactaatgca
atcttgacgacgtttaacgaggttgatatgagtgcagttatggcacttagaaataagtat
aaagatatattccttaaagagcatgatataaagcttggttttatgtctttctttattaaa
gcagcaactgaagcacttaaaaagttcccagatgttaatgcttctattgatggtgatgag
attgtttatcataactactttgatattggtatagctgttggtacggatagaggcttagta
gtacctattttaagagatatagatggtaaatctttagcggagcttgaagcagatgtgctt
gataaagcaattaagggtcgcgatggtaaattaagcctagaggatatgcaaggtggtacg
tttacaattactaatggtggtacttatggatctatgttatctacaccaatcattaactca
ccacaaagtgcgatcttaggtatgcataatatcgttgaaagaccagtagttgtaaatggc
gagattaaaatccgtccaataatgtatttagcattatcttatgatcatagaattattgat
ggtggtacatctgtacgattcctgaaaatgattaaagaattgttagaagatccaaataga
attttactacaagtttaa

DBGET integrated database retrieval system