KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0575Help
Entry
OOM_0575          CDS       T02112                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:fna01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fna01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fna00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fna00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:fna00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553437..554198
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGSSASIKELCKGISEVDYNSEKVVVAVFPSSVYVKEVLAQLPKEIGVG
LQNITFYDNGAYTGELSAEMLHDVGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVV
PVVCIGESLEDRQGGRLEKVLTIQLSPILENLSIEQLAKVVIAYEPVWAIGTGVVASLEQ
VQETHQFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggaaattggaaaatgaatggtagctctgcaagcattaaagag
ctttgcaagggtatttcggaagttgattacaatagtgaaaaagtcgttgttgctgttttt
ccttcaagtgtatatgttaaagaggtgcttgcgcagcttcctaaagaaattggagtaggt
ctgcaaaatattactttttatgataatggtgcatatactggagagttatctgcagagatg
ttacatgatgttggttgtaattatctacttataggccattctgagagaagatctttgttt
ggtgaaactgatcaagatgttttcaaaaaacttaataaaattatagatacatcagttgtg
ccagttgtatgtataggtgagtcgctagaagatagacaaggcggaaggttagaaaaagta
ctaacaatacaattaagtccaatattagaaaatttatctattgagcaacttgctaaggtt
gtaatagcttacgaacctgtttgggctataggtacaggagtggtagcatctttggagcaa
gtacaagaaacgcatcaatttattcgttcgcttgtagctaaagttgatgaaaatcttgct
aaaaatatgaaaatagtgtacggtggtagcctgaaagctgaaaatgctaaagatatatta
agcttaccagatgttgatggtggcttgattggtggagcatctttgaaagcttctgagttt
aacgaaataataaatcaagcaaataaaatatgtacggaataa

DBGET integrated database retrieval system