KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0575Help
Entry
OOM_0575          CDS       T02112                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OOM_0575
   01230 Biosynthesis of amino acids
    OOM_0575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_0575
   00051 Fructose and mannose metabolism
    OOM_0575
   00562 Inositol phosphate metabolism
    OOM_0575
Enzymes [BR:fna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OOM_0575
Exosome [BR:fna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OOM_0575
  Exosomal proteins of bladder cancer cells
   OOM_0575
  Exosomal proteins of melanoma cells
   OOM_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553437..554198
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGSSASIKELCKGISEVDYNSEKVVVAVFPSSVYVKEVLAQLPKEIGVG
LQNITFYDNGAYTGELSAEMLHDVGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVV
PVVCIGESLEDRQGGRLEKVLTIQLSPILENLSIEQLAKVVIAYEPVWAIGTGVVASLEQ
VQETHQFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggaaattggaaaatgaatggtagctctgcaagcattaaagag
ctttgcaagggtatttcggaagttgattacaatagtgaaaaagtcgttgttgctgttttt
ccttcaagtgtatatgttaaagaggtgcttgcgcagcttcctaaagaaattggagtaggt
ctgcaaaatattactttttatgataatggtgcatatactggagagttatctgcagagatg
ttacatgatgttggttgtaattatctacttataggccattctgagagaagatctttgttt
ggtgaaactgatcaagatgttttcaaaaaacttaataaaattatagatacatcagttgtg
ccagttgtatgtataggtgagtcgctagaagatagacaaggcggaaggttagaaaaagta
ctaacaatacaattaagtccaatattagaaaatttatctattgagcaacttgctaaggtt
gtaatagcttacgaacctgtttgggctataggtacaggagtggtagcatctttggagcaa
gtacaagaaacgcatcaatttattcgttcgcttgtagctaaagttgatgaaaatcttgct
aaaaatatgaaaatagtgtacggtggtagcctgaaagctgaaaatgctaaagatatatta
agcttaccagatgttgatggtggcttgattggtggagcatctttgaaagcttctgagttt
aacgaaataataaatcaagcaaataaaatatgtacggaataa

DBGET integrated database retrieval system