KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0575Help
Entry
OOM_0575          CDS       T02112                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00010  Glycolysis / Gluconeogenesis
fna00051  Fructose and mannose metabolism
fna00562  Inositol phosphate metabolism
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
fna01120  Microbial metabolism in diverse environments
fna01130  Biosynthesis of antibiotics
fna01200  Carbon metabolism
fna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_0575
   00051 Fructose and mannose metabolism
    OOM_0575
   00562 Inositol phosphate metabolism
    OOM_0575
Enzymes [BR:fna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OOM_0575
Exosome [BR:fna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OOM_0575
  Exosomal proteins of bladder cancer cells
   OOM_0575
  Exosomal proteins of melanoma cells
   OOM_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFJ43093
UniProt: I2AY46
Position
553437..554198
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGSSASIKELCKGISEVDYNSEKVVVAVFPSSVYVKEVLAQLPKEIGVG
LQNITFYDNGAYTGELSAEMLHDVGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVV
PVVCIGESLEDRQGGRLEKVLTIQLSPILENLSIEQLAKVVIAYEPVWAIGTGVVASLEQ
VQETHQFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggaaattggaaaatgaatggtagctctgcaagcattaaagag
ctttgcaagggtatttcggaagttgattacaatagtgaaaaagtcgttgttgctgttttt
ccttcaagtgtatatgttaaagaggtgcttgcgcagcttcctaaagaaattggagtaggt
ctgcaaaatattactttttatgataatggtgcatatactggagagttatctgcagagatg
ttacatgatgttggttgtaattatctacttataggccattctgagagaagatctttgttt
ggtgaaactgatcaagatgttttcaaaaaacttaataaaattatagatacatcagttgtg
ccagttgtatgtataggtgagtcgctagaagatagacaaggcggaaggttagaaaaagta
ctaacaatacaattaagtccaatattagaaaatttatctattgagcaacttgctaaggtt
gtaatagcttacgaacctgtttgggctataggtacaggagtggtagcatctttggagcaa
gtacaagaaacgcatcaatttattcgttcgcttgtagctaaagttgatgaaaatcttgct
aaaaatatgaaaatagtgtacggtggtagcctgaaagctgaaaatgctaaagatatatta
agcttaccagatgttgatggtggcttgattggtggagcatctttgaaagcttctgagttt
aacgaaataataaatcaagcaaataaaatatgtacggaataa

DBGET integrated database retrieval system