KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0575Help
Entry
OOM_0575          CDS       T02112                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OOM_0575
   01230 Biosynthesis of amino acids
    OOM_0575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_0575
   00051 Fructose and mannose metabolism
    OOM_0575
   00562 Inositol phosphate metabolism
    OOM_0575
Enzymes [BR:fna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OOM_0575
Exosome [BR:fna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OOM_0575
  Exosomal proteins of bladder cancer cells
   OOM_0575
  Exosomal proteins of melanoma cells
   OOM_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553437..554198
Genome map
AA seq 253 aa AA seqDB search
MQKLIMGNWKMNGSSASIKELCKGISEVDYNSEKVVVAVFPSSVYVKEVLAQLPKEIGVG
LQNITFYDNGAYTGELSAEMLHDVGCNYLLIGHSERRSLFGETDQDVFKKLNKIIDTSVV
PVVCIGESLEDRQGGRLEKVLTIQLSPILENLSIEQLAKVVIAYEPVWAIGTGVVASLEQ
VQETHQFIRSLVAKVDENLAKNMKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKASEF
NEIINQANKICTE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattaataatgggaaattggaaaatgaatggtagctctgcaagcattaaagag
ctttgcaagggtatttcggaagttgattacaatagtgaaaaagtcgttgttgctgttttt
ccttcaagtgtatatgttaaagaggtgcttgcgcagcttcctaaagaaattggagtaggt
ctgcaaaatattactttttatgataatggtgcatatactggagagttatctgcagagatg
ttacatgatgttggttgtaattatctacttataggccattctgagagaagatctttgttt
ggtgaaactgatcaagatgttttcaaaaaacttaataaaattatagatacatcagttgtg
ccagttgtatgtataggtgagtcgctagaagatagacaaggcggaaggttagaaaaagta
ctaacaatacaattaagtccaatattagaaaatttatctattgagcaacttgctaaggtt
gtaatagcttacgaacctgtttgggctataggtacaggagtggtagcatctttggagcaa
gtacaagaaacgcatcaatttattcgttcgcttgtagctaaagttgatgaaaatcttgct
aaaaatatgaaaatagtgtacggtggtagcctgaaagctgaaaatgctaaagatatatta
agcttaccagatgttgatggtggcttgattggtggagcatctttgaaagcttctgagttt
aacgaaataataaatcaagcaaataaaatatgtacggaataa

DBGET integrated database retrieval system