KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0620Help
Entry
OOM_0620          CDS       T02112                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    OOM_0620
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     OOM_0620
Exosome [BR:fna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OOM_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604364..605863
Genome map
AA seq 499 aa AA seqDB search
MSKQFILAIDQGTTSSRAIIFDKKGNIKKIAQKEFTQIYPKSGWVEHDPMEIWASQSSIV
REALEYARVSPRDIAAIGITNQRETTVVWDKNTGQPVYNAIVWQCRRTSHICDEINKNED
LKKYIRKNTGLIVDAYFSATKIKWILDNVDGAREKAEKGNLLFGTIDTWLIWNLTKGEVH
ATDFSNASRTMLFNINTLEWDKKVLEYLDIPVSMLPEVRSSSGDFGHTHPSTLGGARIPI
AGVAGDQQSALFGHCCFEEGMAKNTYGTGCFALMNVGDKPIFSDAGLLTTIAWAEDGKPT
YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTDGVYLVPAFVGLGTPYWDMY
ARGTIVGITRDTGREHIIRAALEAIAYQAKDILDCMKEDTGLDLTGLRVDGGAVQNNFLM
QFQSDILQSEISKPKISEITGLGVVFLAGLAVGFWKDKEELKTILTTEKTFEPKKDHKTV
AHDYKGWKKAVQRSMAWAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaatttatattggcaatagatcaaggtactactagttcacgagcaataatt
tttgataaaaaaggaaatatcaaaaaaatagcacaaaaagagtttacacagatttatcca
aaaagtggttgggtagagcatgatccaatggaaatatgggcatcacaaagtagtattgtt
agagaagctcttgagtatgctagagtttctcctagagatatagcagcgattggtatcact
aaccaaagagaaacaactgttgtttgggataaaaatacaggtcaaccagtatataatgct
atagtgtggcagtgtcgtagaacatcgcatatttgtgatgaaattaacaagaacgaagat
cttaaaaaatatatccgtaaaaacacaggtcttattgttgatgcgtatttctctgccaca
aaaatcaaatggattttagacaatgttgacggagctagagaaaaagcagaaaaaggaaat
ttactttttggaacaattgatacttggttaatctggaatttaactaagggtgaagttcac
gctactgacttttcaaatgcttcaagaacaatgttgttcaatatcaatacacttgaatgg
gacaaaaaagttctagagtatttagatattccagtatcaatgttgccagaggttagatct
tcgagtggtgattttggacatacacaccctagcactctaggaggtgcgcgcattccaata
gcaggagttgctggagatcagcagtcagcattgtttggacactgctgttttgaagaagga
atggcaaaaaatacttatggtacgggatgttttgctctaatgaatgtgggtgacaagcct
atattttctgatgctggtttactgactacaatcgcttgggctgaggatggtaaaccaacc
tatgctttagaggggagtgtctttattgcaggagcagttatccaatggattagagatggt
ctaggtcttgtacgttctgcagaggatagtgagtactatgcaacaaaaatagactcaact
gatggtgtgtacttggtaccagcatttgttggacttggtacgccatattgggatatgtat
gctcgtgggactattgttggtatcactcgagatactggacgtgagcatattattagagcg
gctcttgaggctatagcttatcaagcaaaggatattttagattgtatgaaagaagatacc
ggtcttgatttgacaggtcttcgtgtcgatggtggtgcagtgcaaaataatttcttgatg
caatttcaatcagatatcttacagtcagaaatttctaagcctaaaattagtgagattaca
ggtttgggagtggtattcttggcaggtctggctgtaggattctggaaagataaagaagaa
cttaagactattcttacaacagaaaaaacttttgagccgaaaaaagatcataaaactgta
gcacatgattacaaaggctggaaaaaagcagttcaaagaagtatggcttgggctgaataa

DBGET integrated database retrieval system