KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0637Help
Entry
OOM_0637          CDS       T02112                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    OOM_0637
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    OOM_0637
Enzymes [BR:fna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     OOM_0637
Lipid biosynthesis proteins [BR:fna01004]
 Desaturase
  First
   OOM_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626096..627262
Genome map
AA seq 388 aa AA seqDB search
MNNNEIIHQTIEKEGSIVWKSIFGLLLLPLVTIIAVPWYAMTYGFSTSDYVCLIVFYALT
GVGITMGYHRLWSHKTYKANKIVSYALMVFGTAALQNSIIQWASDHRKHHKDVDDPVKDP
YAATRGFWFSHFGWLLRHSSSDVQEIRGVNDLLKDKAVVFQHNHYTVLAILACFGLPTLI
GFIFGFLTGGTLTAAWQSALGFLILGGLLRVVLVHHATFCINSLAHTIGKRPYSTKNTAR
DSWITAIVTGGEGYHNYHHAFAGDYRNGIRWFDLDPSKWFIVGLAKIGWCYDLKTTPKHL
IEIAKAKVKLDEALTKKNKTFDLGIEELYAKLVANVKSMYSAKQEYLKAKKENVLSKADI
KDIKSKYKDLKIEFIQAKKKYNKASTMA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgaaataatacatcaaaccatcgaaaaagaaggtagtatagtttggaaa
agtatcttcggattattacttcttccgttagttacaattattgctgtaccgtggtatgcg
atgacttatggcttctcaacttcagactatgtttgtttaattgttttctatgcacttaca
ggtgttggtatcacaatgggctatcatagactttggtcacataaaacttataaggctaat
aagatagtaagttatgctcttatggtttttgggacagcggctttacagaatagtataatt
cagtgggcttcagatcatagaaagcaccataaagatgttgatgatcctgtaaaagaccct
tatgcagcgactagaggtttttggttctcacactttggttggttattaagacatagtagt
tctgatgtccaagaaattagaggagttaatgatcttctaaaagataaggcggtggtgttc
caacataatcattatactgtgttagctattttagcatgttttggattgcctacattaata
ggatttatatttggattcttaacaggcggtacgttaactgcagcttggcagagtgcttta
ggttttctaattttaggtggcttacttagagttgttttagttcatcatgcaactttttgt
attaactctttagcgcatactattggaaaaagaccatactctacaaaaaatacagcgaga
gatagttggataacagctatagtgactggtggagaaggttatcataactatcatcatgct
tttgctggtgattatagaaatggtattagatggtttgatcttgatccatcaaaatggttt
attgtcgggttagcaaaaataggttggtgttatgatcttaaaactacgcctaagcatttg
attgaaattgcaaaagcgaaggttaaattggatgaagctctaactaagaaaaataagacg
tttgacttgggtattgaagagttatatgccaagttggttgctaatgtgaaaagtatgtat
agtgctaagcaagagtacctaaaagcgaagaaagaaaatgtactatctaaagctgatata
aaagatataaaatctaaatataaagatttaaaaatcgaatttattcaagcgaagaaaaaa
tataacaaagctagtactatggcatag

DBGET integrated database retrieval system