KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0732Help
Entry
OOM_0732          CDS       T02112                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OOM_0732
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_0732
   00020 Citrate cycle (TCA cycle)
    OOM_0732
   00620 Pyruvate metabolism
    OOM_0732
Enzymes [BR:fna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OOM_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721480..723054
Genome map
AA seq 524 aa AA seqDB search
MSIEIVKVPDIGDYDSVDVIEVNVAEGDVIAEEDSLITLETDKASMEVPSPVAGKVVEII
TKVGDKVSQGSLILKVETGASASVATQAPAQQVAPAQSATEEVVDVKVPDIGDYDSVDVI
EVSVAVGDTIAEEDSLITLETDKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVKTKG
TAPIAAPSQPAKQEAPKQEAQPAVSALATQTNVNEYAVDNSKAHASPAVRKLARILNVDL
RKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDLVVDFAKFGEIETQP
LTRINKISAKNLHRNWVKIPHVTFYDDADVTDLEEFRKSKKAFSEKTGVKITPLSFLVKA
AAVALQEFPRMNSSLSNDGENLILKKYYNIGFAADTPAGLMVPVIKDADKKGIIEISKDI
LELAGKARDGKLSAKDMTGATFTISSIGVLGTTAFTPIINMPEVAIMGVSKTAVKPVWNG
KEFEPRTMLPLSMSADHRVIDGALAAKFLTRYCQILSDLREIIM
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagttcctgatattggggattatgatagtgtagatgtgatc
gaagttaatgttgctgaaggtgatgttatcgctgaagaagattctttgattacattagaa
acagataaagctagtatggaagtaccatctcctgttgctggaaaagttgttgagattatc
acaaaggttggtgataaagtttcgcaaggtagcttgatattaaaagttgagactggagca
agtgcttcagtagctacacaagcgccagcacagcaagttgcacctgcacagtcagctact
gaagaagttgtagatgtcaaagttccggatattggtgattatgatagtgttgatgttatc
gaagtatcagtggctgtcggtgatacaattgctgaagaagattctttgattacgttagaa
actgataaggctagtatggaggttccatctcctgtagctggcgaagttgttgagattatc
acaaaggttggtgataaagtttcgcaaggtagcttaattcttaaggtcaagacaaagggc
acagctcctatagcagcacctagtcagccagcaaagcaagaagctcctaagcaagaagct
caaccagcagtatctgctttagcgactcaaactaatgttaatgaatatgccgtagataat
tcaaaagctcatgcttctccagctgttagaaagctagctagaattttaaatgttgattta
agaaaagttaaagctacaggtcgtaaaggacgtgtaacaaaagaagattgttataactac
atcaagcacgctgtaacacaagttcagactggtaaagtcgctgctagtggtagtggttta
gatcttctagatgatctagtggtagacttcgctaagtttggtgagattgaaactcaacca
ttgactcgtatcaacaaaattagtgcaaaaaatctacatagaaactgggttaaaattcca
catgttactttctatgatgatgcagatgttactgatcttgaagagtttagaaagtctaaa
aaagcattttctgagaaaactggagttaagattacgccgttatcattcttggtcaaagct
gcagctgtagcacttcaagagttcccgagaatgaatagttcgctatcaaatgatggtgaa
aacttgatattgaagaaatactacaatattggctttgctgctgatactccagctgggcta
atggttccagttatcaaggatgctgacaaaaaaggtattattgaaatatcaaaagatatt
ctggaattagctggtaaagcgcgtgatggtaaattaagtgccaaagatatgactggggct
acatttactatctctagtataggtgtgcttgggactacagcatttacaccaattattaat
atgccagaagtagcgattatgggtgtatctaagactgctgttaaaccagtgtggaatggt
aaagaatttgaacctagaactatgctacctctatctatgtcagcagatcacagagtaatt
gatggtgcattagctgctaagttcttaactagatattgtcagattttatctgatttacgt
gaaatcataatgtaa

DBGET integrated database retrieval system