KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0789Help
Entry
OOM_0789          CDS       T02112                                 

Definition
(GenBank) arsenate reductase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00220  Arginine biosynthesis
fna00330  Arginine and proline metabolism
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
fna01130  Biosynthesis of antibiotics
fna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    OOM_0789
   00330 Arginine and proline metabolism
    OOM_0789
Enzymes [BR:fna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     OOM_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFJ43263
UniProt: I2AYL6
Position
768320..769189
Genome map
AA seq 289 aa AA seqDB search
MKKVEAVGIAIGNAGREIGCGRAPYALLNELRDRRIDAQIINYIGGRAEVPTMGKYFTKV
AQRVSEILKEGKFPLALGGDHSCAIGTWSGVYDYLKSQKKELGLIWIDAHMDSHRPETSE
TGNIHGMPVAHLLGYGHEELTKVLNDNPKLKPKNIVFFGIRSYEKPERDFLEKLGVKVYY
QTDLTDRNFEELFLQEFERLEKVTEGNVGISFDLDGLDPTNLDAVGTPVENGIDPQVFYK
TIEKINFNSLVCFEVAEYNPLIDKTEISLKYMSKLIRLVEGNIKNLTQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagaggcagtaggaatagctattggtaatgctggcagagaaattggttgt
ggaagagctccatatgctttgttgaatgagttaagagatagacgtatagatgctcaaatt
atcaattatattggtggaagagctgaagtacctactatgggtaagtattttaccaaggtt
gctcaacgagtatctgaaattcttaaagagggtaagtttcctttggctctaggaggagat
cactcatgtgcgataggtacatggagtggggtttatgattatcttaaaagtcagaaaaaa
gagcttggtttgatttggattgatgctcatatggacagtcatagaccagaaacttctgag
acgggtaatattcatggtatgcctgtagcacatcttttaggatatggacatgaggaatta
acaaaggtactaaatgataatcctaagttaaagcctaagaatattgttttctttggaatt
cgctcttatgaaaagccagaaagagattttttggaaaaattaggtgttaaagtttattat
caaacagatttaactgatagaaactttgaagaattatttttacaagagtttgaacgtctt
gagaaggttacagagggtaatgtagggattagttttgatttggatggtttagatcctact
aaccttgatgctgtaggaactccagttgaaaatggtattgatccacaagttttttacaaa
actattgagaaaattaattttaatagtttagtttgttttgaagtggcagaatataatcct
ctgattgataaaacagaaatctcgcttaaatatatgtcaaaactaataagattagttgaa
ggcaatataaaaaatctaacacaaaaatag

DBGET integrated database retrieval system