KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0789Help
Entry
OOM_0789          CDS       T02112                                 

Definition
arsenate reductase (EC:1.20.4.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OOM_0789
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OOM_0789
Enzymes [BR:fna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     OOM_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
768320..769189
Genome map
AA seq 289 aa AA seqDB search
MKKVEAVGIAIGNAGREIGCGRAPYALLNELRDRRIDAQIINYIGGRAEVPTMGKYFTKV
AQRVSEILKEGKFPLALGGDHSCAIGTWSGVYDYLKSQKKELGLIWIDAHMDSHRPETSE
TGNIHGMPVAHLLGYGHEELTKVLNDNPKLKPKNIVFFGIRSYEKPERDFLEKLGVKVYY
QTDLTDRNFEELFLQEFERLEKVTEGNVGISFDLDGLDPTNLDAVGTPVENGIDPQVFYK
TIEKINFNSLVCFEVAEYNPLIDKTEISLKYMSKLIRLVEGNIKNLTQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagaggcagtaggaatagctattggtaatgctggcagagaaattggttgt
ggaagagctccatatgctttgttgaatgagttaagagatagacgtatagatgctcaaatt
atcaattatattggtggaagagctgaagtacctactatgggtaagtattttaccaaggtt
gctcaacgagtatctgaaattcttaaagagggtaagtttcctttggctctaggaggagat
cactcatgtgcgataggtacatggagtggggtttatgattatcttaaaagtcagaaaaaa
gagcttggtttgatttggattgatgctcatatggacagtcatagaccagaaacttctgag
acgggtaatattcatggtatgcctgtagcacatcttttaggatatggacatgaggaatta
acaaaggtactaaatgataatcctaagttaaagcctaagaatattgttttctttggaatt
cgctcttatgaaaagccagaaagagattttttggaaaaattaggtgttaaagtttattat
caaacagatttaactgatagaaactttgaagaattatttttacaagagtttgaacgtctt
gagaaggttacagagggtaatgtagggattagttttgatttggatggtttagatcctact
aaccttgatgctgtaggaactccagttgaaaatggtattgatccacaagttttttacaaa
actattgagaaaattaattttaatagtttagtttgttttgaagtggcagaatataatcct
ctgattgataaaacagaaatctcgcttaaatatatgtcaaaactaataagattagttgaa
ggcaatataaaaaatctaacacaaaaatag

DBGET integrated database retrieval system