KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0881Help
Entry
OOM_0881          CDS       T02112                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OOM_0881
Enzymes [BR:fna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OOM_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870508..871266
Genome map
AA seq 252 aa AA seqDB search
MKILVCRPKDDADKLSQLLRSEGYTAISLPCINIDYIRITSSVLDYTSYIFTSKYAIESL
FAQYNPKLFQDKKLYSVGQTTAKTLKRYGLDAIYPHNHGSQELLKLIIEEDVSDDSFAVI
SGVSGNELLVKEISQLTKCDKFETYQRVFESITVLSQSYLKVIDDGIHPDVIIATSIAVF
RSLNRVFDEIVAPTAAIITITSPKMLEFVNEQGFENTLKLEKLDNNCIYQKIREHIEAKN
VTGKKYSARANQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctaaggatgatgctgataagctttcacaattactaaga
tctgaagggtacacagctataagtttgccatgtattaatatagattatattagaataaca
agttcagtactggattatacaagttatatatttactagcaaatatgccattgagagtttg
tttgctcaatataatcctaaattgtttcaagataaaaaactctacagcgtaggtcaaact
actgcaaaaactctaaaaagatatggtttagatgctatatatccacataatcatggttca
caagagcttctaaagctaatcatagaagaagatgtctctgatgatagttttgcggttatc
tctggagtttctggaaatgaattgcttgttaaagaaatatcacaactaacaaagtgcgat
aaatttgaaacttatcagagagtttttgagagtattactgtgcttagtcaatcgtatttg
aaagtgattgatgatggtatacatcctgatgtaatcattgcaacaagtatagctgttttt
agatctttgaatagagtttttgatgaaatagtagctcccacagctgcaattattaccata
acaagcccgaaaatgttagaatttgttaatgaacaaggctttgaaaatactttgaagctt
gagaaattagataataactgtatctatcaaaaaatacgagaacatattgaggctaagaat
gtcacaggaaaaaaatattcagcaagagcaaaccaataa

DBGET integrated database retrieval system