KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_0881Help
Entry
OOM_0881          CDS       T02112                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00860  Porphyrin and chlorophyll metabolism
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
fna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OOM_0881
Enzymes [BR:fna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     OOM_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 KcnmB2_inactiv Peptidase_U32
Motif
Other DBs
NCBI-ProteinID: AFJ43354
UniProt: I2AYV7
Position
870508..871266
Genome map
AA seq 252 aa AA seqDB search
MKILVCRPKDDADKLSQLLRSEGYTAISLPCINIDYIRITSSVLDYTSYIFTSKYAIESL
FAQYNPKLFQDKKLYSVGQTTAKTLKRYGLDAIYPHNHGSQELLKLIIEEDVSDDSFAVI
SGVSGNELLVKEISQLTKCDKFETYQRVFESITVLSQSYLKVIDDGIHPDVIIATSIAVF
RSLNRVFDEIVAPTAAIITITSPKMLEFVNEQGFENTLKLEKLDNNCIYQKIREHIEAKN
VTGKKYSARANQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctaaggatgatgctgataagctttcacaattactaaga
tctgaagggtacacagctataagtttgccatgtattaatatagattatattagaataaca
agttcagtactggattatacaagttatatatttactagcaaatatgccattgagagtttg
tttgctcaatataatcctaaattgtttcaagataaaaaactctacagcgtaggtcaaact
actgcaaaaactctaaaaagatatggtttagatgctatatatccacataatcatggttca
caagagcttctaaagctaatcatagaagaagatgtctctgatgatagttttgcggttatc
tctggagtttctggaaatgaattgcttgttaaagaaatatcacaactaacaaagtgcgat
aaatttgaaacttatcagagagtttttgagagtattactgtgcttagtcaatcgtatttg
aaagtgattgatgatggtatacatcctgatgtaatcattgcaacaagtatagctgttttt
agatctttgaatagagtttttgatgaaatagtagctcccacagctgcaattattaccata
acaagcccgaaaatgttagaatttgttaatgaacaaggctttgaaaatactttgaagctt
gagaaattagataataactgtatctatcaaaaaatacgagaacatattgaggctaagaat
gtcacaggaaaaaaatattcagcaagagcaaaccaataa

DBGET integrated database retrieval system