KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1017Help
Entry
OOM_1017          CDS       T02112                                 

Definition
glutathione peroxidase (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    OOM_1017
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OOM_1017
Enzymes [BR:fna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     OOM_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1010982..1011452)
Genome map
AA seq 156 aa AA seqDB search
MSIYDFKLTRNDGSEYYLPKNKVLLIVNVASKCGFTKQYRGLQHLHKLHPDLEIVAFPCN
SFGGQEPGSDEEIKNFCQTNYDVTFPIMKKTKVNGKDAEPLYEYLKERAKGVLGTEAIKW
NFTKFLVSKDGGTVIRYAPKTIPEDLIADIENFLKD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgactttaaattaactaggaatgatggctcagaatattatttacccaag
aataaggttctcttgatagtaaatgttgcgagtaagtgcggattcactaagcaatataga
ggacttcaacatttacataaattacatccagatctagagatagtagcttttccatgtaat
tcatttggtggacaagaacctggtagtgatgaagaaattaaaaacttttgtcaaactaac
tatgatgttacatttccaataatgaaaaaaacaaaagtaaatggtaaagatgcagaacca
ctatatgaatatcttaaagaaagagcaaaaggtgtacttggtaccgaagctataaaatgg
aattttacaaaatttttagtatcaaaagatggtggaactgtcattagatatgcacctaaa
acaattcctgaagatctaatcgctgatatcgaaaattttcttaaagattaa

DBGET integrated database retrieval system