KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1085Help
Entry
OOM_1085          CDS       T02112                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OOM_1085
Enzymes [BR:fna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OOM_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091130..1092569
Genome map
AA seq 479 aa AA seqDB search
MKKSGLLLAISSLPSQFGIGDLGKRAYEFVDILKQANTKIWQVLPLTPLGFGNSPYQSSS
SFAGDEIYISLEKLVDYGLLEESSLKNLNANFDKVEYELVRNFKDNYLEEAFSSFQSSKD
KFEQEYNNFIAQNTWVKNYAILKAFRKANNNQAWNFWPQEYKNWIKDKAIELDQFQNEID
YQIFLQFIFYKQWFELREYANQHGIEIMGDLPIYLGFDSADVWEHQDIFLLDENQNLSFV
AGVPPDFFSETGQLWGNPLYYWDKLKETNFDFWIDRLNGNFKLFDIVRIDHFRAFDTYWK
IPAGEKTAINGEWVEAPGYDFFDTVYKRIPDANIIAEDLGDLRPEVLELRDHYKLKGMKV
FPFHFDLKTAKFVEDSNIIAYSGTHDNNTLKGWYFDELNRYQRKLLKRYFKANDRNIFGK
IIKYLLNCDAEYVILPVQDILELDSNARLNTPGTVGEPNWQWKLTDFDGLHRFIQRLVK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctggattattattagctatctcaagtttaccaagtcaatttggtatcggt
gacttgggtaaaagagcttatgaatttgttgatatcctaaaacaagcaaatactaagatt
tggcaggtattaccacttacgccactaggctttggtaattcaccatatcagtcaagctct
tcttttgcgggcgatgaaatctatattagcttagaaaaactagtagattatggtttgctt
gaagaatcatctcttaaaaatctaaatgcaaattttgacaaagttgaatatgaacttgtt
cgtaatttcaaagataattatcttgaagaagcatttagtagttttcaaagctcaaaagat
aagtttgaacaagaatataataattttatagctcaaaacacttgggttaaaaattatgct
attttaaaagcttttagaaaggctaataataatcaagcttggaatttttggccgcaagaa
tataaaaactggatcaaagacaaggctatagagcttgatcaatttcaaaacgagatagat
tatcaaatatttttacagtttattttttataagcagtggtttgagctaagagagtatgcg
aatcagcatggtatcgaaatcatgggtgatttgcctatttatcttggttttgactctgct
gatgtttgggagcatcaagatatatttttattagatgagaatcaaaatcttagttttgtc
gcaggagttccacctgactttttctcagaaactggtcagctatggggcaaccctttatat
tattgggataagctcaaagaaacaaactttgatttttggatagatcgattaaatggtaac
ttcaaactatttgatattgttaggattgatcattttagagcttttgatacatattggaag
atacctgcaggtgaaaaaactgctataaatggtgaatgggtagaagctcctggttatgat
ttttttgatactgtgtataagcgtattccggatgctaatattattgctgaagatttaggt
gatttacgccctgaagtacttgagttgcgtgatcactacaagttaaaaggtatgaaggtt
tttccatttcactttgatcttaaaacggctaagtttgttgaagatagtaatatcattgca
tattcaggaactcatgataataatactctcaaaggttggtattttgatgagttaaacaga
taccaaagaaagcttttaaaacgttattttaaagctaatgatagaaatatttttggaaag
attattaagtatttactaaattgtgatgctgaatatgtaatattgccagtacaagatatt
cttgaattagatagtaatgctagactaaatactccaggtacagtaggcgaacctaattgg
caatggaaattgactgattttgatgggttgcatcgatttatacagaggttagtgaaatag

DBGET integrated database retrieval system