KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1089Help
Entry
OOM_1089          CDS       T02112                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OOM_1089
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OOM_1089
Enzymes [BR:fna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     OOM_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095460..1096893
Genome map
AA seq 477 aa AA seqDB search
MKSINQILKFLDIQTLSPNNFEIELLSLDSRKSDEKSAFIALKGLSTDGNKYIDSVLAKG
VSLVLTDSHEFEDHKCIFYIQNLKEKLSNLAKWFYDYKKPQNIIGITGTNGKTSISSYIA
QLQKLIGQKSLLLGTNGNGIYPDLQESTHTTLDILSLYQTISYYKNYQNLVMEVSSHSLD
QKRTKGLDFDIAVFSNLSHDHLDYHKTMDNYFEAKAKLFQFKSLKKAVISIDDEYGLKLC
KVCNCEIVRVSLKSKNADIYIESNSIENMQTSFDLYISQKYIGTYQTCLVGEFNLMNLGL
SLAALDDGSTRDQLLENISKLKPVKGRMEVIALTNGAKIIIDYAHTPDALEKVLQTLANY
SPNNLWCIFGCGGNRDTTKRPIMAKIAEKYASKIVITEDNNRFENIESIFDDIKKGFNHP
EKHIFIDSRENAIKYTIENSKVNDVILLAGKGHECYLDKNGIKEYFDEREVIAKYNF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtataaatcaaatattaaaatttctagatattcaaactttatctccaaataat
tttgaaattgaattgctatctttagatagtcgtaaatctgatgaaaaatcggcatttata
gctctcaaaggactatcaaccgatggtaataaatatattgatagtgttttagctaaaggt
gtcagtttagtattaacagatagtcatgaatttgaagatcataaatgtattttctatatt
caaaatttaaaagagaagctatcgaatcttgctaaatggttttatgattataaaaaacct
caaaatataattggcataacaggcacaaatggtaaaacatcaatttctagttatattgca
caattgcaaaaattaattggtcaaaaatcattattactaggtacaaatggcaatgggatt
tatccagatctacaagagagtacccatacgacattagatatattatctttatatcaaact
atttcatattataagaattatcaaaatcttgttatggaagtatcttctcattcattggat
caaaagcgcaccaaaggtttagattttgatattgccgtatttagtaatcttagtcatgat
catcttgattatcataagactatggataattattttgaggctaaagcaaaattgtttcag
tttaaaagccttaaaaaagctgtaataagtatagatgatgaatatggtctgaaattgtgt
aaagtttgtaactgtgaaatagtaagagtcagcctaaaatcaaaaaatgcagatatttat
atagagtctaacagtattgagaatatgcaaacaagctttgatttatatatttctcaaaag
tatattggtacttatcaaacatgtttagttggcgaatttaatctaatgaatttaggtttg
agcttagcggcattagatgatggctctactagagatcaacttctagaaaatatttctaaa
ttaaaacctgtaaaagggcgtatggaagtaatcgcattgacgaatggtgctaaaatcata
attgactatgcgcatactccagatgctttggaaaaggttttacaaactctagctaactat
agcccaaataatctatggtgtatttttggttgtggtggcaatagggatactaccaaaaga
cctataatggctaaaatagctgaaaagtatgctagtaaaatagtcattactgaagataat
aatcgttttgaaaatattgaaagtatttttgatgatatcaaaaaaggttttaatcatcct
gaaaagcatatttttattgatagcagagaaaatgctatcaaatatactattgaaaactcg
aaagttaacgatgttattctattagctggcaaaggacatgagtgctatcttgataaaaat
ggtattaaagagtattttgatgagcgagaggttatcgctaagtataatttttaa

DBGET integrated database retrieval system