KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1096Help
Entry
OOM_1096          CDS       T02112                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fna01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fna00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fna00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1104468..1105754
Genome map
AA seq 428 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQFGLALDGGLFVSERFPTVDWQSFAKDISYAEFAVNTLREF
FKGDQLEASLDKICNNAFTFDVPVKRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKVNIRVIVMFPEGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIDEISMSLNANDIVIDYLNTGEFNPRASVETLANAMD
VGNPSNFERLLYLLGGYENFKANVKAVCVSDFEIIEEIKQVYRQYNEVVCPHTATGFVAK
NQLDANKDYIIVATAHPAKFESVIEPILDIQVPATPALQKLLDKEQHKVEINKSMDELCE
VYAKAFEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtacaagagataaaaatatcaaagtttcattgagtgaggcaatgcaa
tttggattagctctagatggaggactatttgtgtcagagagatttccaacagttgattgg
cagagttttgccaaagatatcagctatgctgaatttgctgtaaatactttgagagagttc
tttaaaggagatcagcttgaagcttctttagacaagatttgtaataatgcttttacattt
gatgtgccagttaagcgcttggataaaactacatctgttttagagctttttcatggacca
actttatcttttaaggattttggtgcgagatttttagcaaattgtttgagttctatagat
agtgagaagccatttacaattttagtagcaacttctggcgatacaggttctgcagtagca
gcagcttttcatggtaaggttaatattcgtgttatagtgatgttccctgaaggtaaaatt
tctaaaagacaagaaaagcaaataacttgttggggcgataatatccaagctgttgaagtt
gaaggagtttttgatgactgtcaaagtttagttaaagaagcttttaagacaccttggtgg
acagaaagaacgaaactaaatacatctaatagtattaatattggtagattactaccacaa
tctacttactatgcttatacatcatggcagcattatttacagactggagagaaagcaaac
tacatagttccatctggtaatattggtaatatcacagctgctttttgggctaaacaaatg
ggcttcccaatagatgagatatctatgagtctaaatgcaaatgatatagttatagattac
ttaaatactggagaatttaacccaagagcaagtgttgagacattggcaaatgcaatggat
gttggtaatccgagtaattttgaaagacttttgtacttattgggtggttatgagaatttc
aaagctaatgttaaagcggtatgcgtttctgattttgaaatcatagaagaaattaagcag
gtctatcgtcagtataatgaagtcgtttgtccacacactgcaacaggttttgtagcaaaa
aaccagcttgatgctaataaggattatataatagtagcgactgcacatcctgctaaattt
gagagcgtaatagagccaatattagatatacaggttccagctacgccagcgttacagaag
ctactagacaaagagcaacataaggtagagataaataagtctatggatgaactttgtgag
gtttatgcaaaagcttttgaagcttaa

DBGET integrated database retrieval system