KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1131Help
Entry
OOM_1131          CDS       T02112                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OOM_1131
Enzymes [BR:fna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     OOM_1131
Exosome [BR:fna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OOM_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137202..1138173
Genome map
AA seq 323 aa AA seqDB search
MSFPISRPRRLRVTQAFRDMVAETNLNIDDLMYPIFVVHGNGIKKEISSMPNQYHWSVDM
LDELVEQVVKSGIKSLMIFGVPKTKDLISSENYDPNGITQQAIRKIKELATELVVATDVC
MCSFTPHGHCGILDEHDYVDNDQTLEILQKTAISHAQAGVDIVAPSGMMDGMIIAMRQAL
DESGFETVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAIREALADVEQ
GADFIMVKPALSYLDIINELSHIIELPIAAYHVSGEYAMIKAAANAGLVDEKAITIETLT
SMKRAGAKIILTYTALDVANWIR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagttttccaatatcacgcccacgtagacttagagttactcaagcctttcgagatatg
gttgctgagacaaatttgaacatagacgatttgatgtatccaatatttgttgtacatggt
aatggtatcaaaaaagaaatctcaagtatgccaaatcaatatcattggtcagttgatatg
cttgatgagcttgttgagcaggttgtaaaatcaggaataaaaagtttgatgatatttggt
gtaccaaaaaccaaagatcttatatcatcagagaattacgatcccaatggtataactcaa
caagcaattagaaaaattaaagagctagctacagagcttgtggtagctacagatgtgtgc
atgtgtagttttacacctcatggacattgtgggattttagatgagcatgattatgtagat
aatgatcaaacattagagatattacaaaaaacagctatttctcatgcacaagctggtgta
gatatcgtcgcaccaagtggaatgatggatggcatgataattgcgatgcgtcaagcattg
gatgagtcaggatttgaaactgtaagtattatgtcatactctgtgaagtatgcttcagca
tattatggtccatttagaagtgcttgtagctcatctcttaagggagatcgtaaaacttat
caaatggattatcgtaataaaaaagaggctatccgtgaagctctagcagatgttgaacaa
ggcgcagactttattatggtcaaaccagcattgagttatttagatattattaatgaattg
agtcatataatagagttgccaatagcagcatatcatgtcagtggagaatatgcgatgatt
aaagctgctgcaaatgcaggtctagttgatgaaaaagcaatcactatagaaacgttgaca
tcgatgaaaagagcaggcgctaaaataattcttacttatacagctttagatgttgcaaac
tggattagatga

DBGET integrated database retrieval system