KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1334Help
Entry
OOM_1334          CDS       T02112                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OOM_1334
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OOM_1334
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OOM_1334
Enzymes [BR:fna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OOM_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344333..1344998
Genome map
AA seq 221 aa AA seqDB search
MLEAQYLLSTKEGLFVELASASTIAHLLKKYEEGKLQKGSTVVCVLSGEGLKDPAVVLKS
AIQPSIIYPAEADFDRLYNSHFFDNKTMLFIEQNEVIFDEVPTLEEVKKTLGKLFGANYD
ENFLTKVRELIERFLVKGKSINVSDIQDIIQDATEMADAISKDILDVKSFKVNVELDQKS
VVEVTVKVADQLYFASSSGVGPVDAVLNALCRACPSDISYS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagcacaatatctattgtcgactaaagaaggattatttgtggaattagcatca
gcgtcaactattgcacatttactcaaaaaatatgaagaaggtaagcttcaaaaaggaagc
acagtagtatgtgtactatctggagaaggtctaaaagatcctgcagtagtgctaaaatct
gctattcagccatcaattatatatccagcagaggctgattttgacagactttataatagt
catttctttgataataagacgatgttattcatagagcaaaatgaggtgatatttgatgaa
gtaccaactcttgaagaagttaaaaaaactcttggtaagttatttggagcaaattatgat
gagaacttcttaactaaggttagagagctaattgagagattcttagttaagggtaaatca
attaatgtatcagatatacaagatattatccaagatgctactgagatggcagatgctatc
agtaaagatatattagatgttaagtcatttaaagtaaatgtagaactagatcaaaaatct
gtagttgaagttactgtcaaagtcgcagatcaattatattttgcatcaagttcaggtgtt
gggccagtagatgccgttttaaatgctttgtgtagagcatgtcctagtgatattagctat
agctaa

DBGET integrated database retrieval system