KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1355Help
Entry
OOM_1355          CDS       T02112                                 

Definition
(GenBank) Holliday junction DNA helicase, subunit A
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fna00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OOM_1355
Enzymes [BR:fna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OOM_1355
DNA repair and recombination proteins [BR:fna03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     OOM_1355
    RecFOR pathway proteins
     OOM_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH 5_3_exonuc HHH_3 Transposase_20 DUF5311 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: AFJ43762
UniProt: I2B015
Position
1364711..1365367
Genome map
AA seq 218 aa AA seqDB search
MMISFIKGTLIEKDPTALLIDVNGLGYEVFVPMTTFYSLGEINSQISLYTHFVVREDAQQ
LYGFKTKVDKKVFQELIKVSGIGARTAIAILSGMDSTTLLHCIENKDYGLLATVPGIGKK
TAERLVVEIYDKLLKMANEIYSQSSDASVSVNTNNSQQAQTPAVISKSIFSESVDALLVL
GYKQKDAEKMIRGTIGESKTAAEAIRKALQGSIRSKNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatgattagttttattaaaggtactttaattgaaaaagatcctacagctttgcttata
gatgttaatggcttaggttatgaagtttttgttccaatgactacattttactcattaggt
gaaattaacagtcaaattagtttgtatacacattttgttgttcgtgaagatgcccagcaa
ttatatggttttaaaacaaaggttgataaaaaagtctttcaagaattaataaaagtaagt
ggaataggtgctaggacagctattgcaatattatcaggtatggattcgacaacactttta
cattgtatcgagaataaagattatgggttgttagctactgtaccgggtattggcaaaaaa
acagctgagcgtttagttgttgagatttatgataaattattaaaaatggcaaatgagatt
tatagtcagtcatctgatgcttcagtatctgtaaatactaataattctcaacaagctcaa
acaccagcggttatttcaaaatcaatctttagtgagtcagtagatgcacttttagttctt
ggctataaacaaaaagatgcagaaaaaatgattcgtggtactattggagaatcaaaaaca
gctgcagaagcaattcgcaaggctcttcaagggtctataagatcaaaaaataaataa

DBGET integrated database retrieval system