KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1405Help
Entry
OOM_1405          CDS       T02112                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OOM_1405
   00052 Galactose metabolism
    OOM_1405
   00500 Starch and sucrose metabolism
    OOM_1405
   00520 Amino sugar and nucleotide sugar metabolism
    OOM_1405
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OOM_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1406591..1407454
Genome map
AA seq 287 aa AA seqDB search
MKIKKVVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKKDETSSYGIVAKD
GENLIKAIVEKPAPEKASSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
EEKILSYEFKGTRYDCGSKLGFLIANYEIALQHKELGSKFKEYLQSR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaagtagtttttccagttgctggttggggaactagatttttgccagca
accaaatcatgtcctaaagagatgttaactgttgtagacaaaccattgattcaatatgct
gttgaggaagctattgaagccggctgtaaagaaattatttttgttacaagttctaacaaa
aaatctctggaagatcattttgatagaaattttgaattagagtattcgttagagaaaaag
caaaagtatgaactattagatttagttaaaaacataattccgaaagatgtaagctttttc
tttgttcgtcagccagaagctttagggctaggacatgctgtgctatgtgcaaaacctctt
gttggaatcgaggattttgcagtgatattgccggatgatttaatctataatcatgattgt
ggtactggtacccttaagcaaatggtgaaagctgtagaaggtactgatatcagaggatgt
atagctactcagcaagtcaaaaaagatgaaactagttcttatggtatcgtagccaaagat
ggtgagaatctcatcaaagctatagttgagaaaccagctccagaaaaagcctcatcgact
aatgcagttgtgggtagatatctattgcctaacaaaattttcagatgtttagagtcaact
tcagaaggtgcaggtggagagattcaattaactgatgcaatcgctaaactactcgatcaa
gaagagaaaattctgtcttatgaatttaaaggtactcgttatgactgtggtagtaaatta
ggctttttaatcgctaactatgaaatagctctacagcacaaagagttaggtagtaaattc
aaagaatatcttcaaagtcgataa

DBGET integrated database retrieval system