KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1406Help
Entry
OOM_1406          CDS       T02112                                 

Definition
(GenBank) acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00010  Glycolysis / Gluconeogenesis
fna00620  Pyruvate metabolism
fna00640  Propanoate metabolism
fna00680  Methane metabolism
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
fna01120  Microbial metabolism in diverse environments
fna01130  Biosynthesis of antibiotics
fna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_1406
   00620 Pyruvate metabolism
    OOM_1406
   00640 Propanoate metabolism
    OOM_1406
  Energy metabolism
   00680 Methane metabolism
    OOM_1406
Enzymes [BR:fna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OOM_1406
Lipid biosynthesis proteins [BR:fna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OOM_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFJ43809
UniProt: I2B062
Position
1407565..1409514
Genome map
AA seq 649 aa AA seqDB search
MSYSNFQVSEEFIAQANVNAEQYEAMYKESIENPEAFWSKQANYISWHKPFDKAFASSFD
PVDIQWFKGGELNVCYNCVDRHLIDKANKVAFVWQADDPYHTKNITYRDLYHRVCEMANI
LEANSVKRGDVVTIYMPMIPEAIYAMLACARIGAMHSVVFGGFSAEALKQRIINANSKFV
ITADESIRSGKRIPLKKSVDRAISGLDFVRNVLVVSRTKTKDMVWNDIDLCYEKECAKVS
DEHKIEFFDVETPLFMLYTSGSTGTPKGLVHTSGGYLVYASMTHKLAFDLKDDDVYWCTA
DIGWITGHSYAVYGPLANGCTSLIFEGVPTYPDASRMWKEVDRHNVKSLYTAPTLIRLLI
KAGDQYLKDSDRTSLIVLGSVGEPINPEVWNWFVEKGANNQAPLVDTWWQTETGGHMILP
LPGAHKLKPGSASKPFFGVDVALLDTDGKEIEGVGKGALCIRTATPGMARTIYGDHDRYI
QTYFSSFKGFYFSGDAARRDEDGYIWIEGRMDDVINVSGHRIATAEIESVLNTHSSVVES
AVVGMPHDIKGEAIYVYCILKDGHDGKGAGDEYLDSIRKTLVSYIRQEIGPVASPDVIQF
TPDLPKTRSGKIMRRILRKIAANDFDNLGDTSTLSDPSIVEYLIKKQIV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattcaaattttcaagtttcagaagagtttatagctcaagctaatgttaatgct
gagcaatatgaagccatgtataaagaatcaatagaaaatccagaggcattttggtcgaag
caggctaattatattagctggcataaaccttttgataaggctttcgcaagtagctttgat
cctgtagatattcaatggttcaaaggtggtgagctaaatgtttgttataactgtgttgac
aggcatttaatagacaaggcaaacaaggtcgcttttgtatggcaagctgatgatccatat
cacactaagaatattacgtatagagatctctatcacagagtatgtgaaatggctaatata
cttgaggcaaatagtgtcaaaagaggtgatgttgtaactatatatatgccaatgatacca
gaagcaatatatgcgatgcttgcttgtgcacgtataggagctatgcactcagttgtattt
ggaggcttttctgcagaggcacttaagcagagaattataaatgcaaatagtaaatttgta
attacagcagatgagagtatcagatcaggtaagagaatacctcttaaaaagagtgtggat
agagcaatctctggtttagactttgttaggaatgtattagttgtgagcagaactaaaaca
aaggatatggtttggaacgatatagatctttgttatgagaaagagtgtgctaaggtctct
gatgaacataagatagaattttttgatgtagaaactccattatttatgttatatacttca
ggctcaactggtactccaaaaggccttgttcatacttcaggaggttatcttgtttacgca
agtatgactcataaattagcttttgatctaaaagatgatgatgtatattggtgtacagct
gatattggctggattactgggcatagttatgctgtttatggtccgcttgctaatggttgt
acctccttaatctttgaaggtgttccaacatatccagatgcttctagaatgtggaaagaa
gttgatagacataatgtgaaatctctatatacagcaccaactttgattagattattaatt
aaagccggcgatcaataccttaaagattcagatagaacttcattaatagtattaggatct
gttggagaacctattaatccagaagtatggaactggtttgtagagaagggtgcaaataat
caagcacctcttgttgatacttggtggcaaacagagactggtggacatatgattctgcca
ttaccaggtgctcataaactaaaaccaggatcggcatctaaacctttctttggagttgat
gtagctttattagatacggatggtaaagagattgaaggagttggtaaaggagctctatgt
attagaactgcgactcctggtatggctagaactatttatggtgaccatgatagatatatt
caaacatattttagtagtttcaaaggtttctatttctcaggtgatgcagctagaagagat
gaagatggttatatctggatagaaggtcgtatggatgatgttattaatgtatcaggccat
agaatagcaactgctgaaatagaatctgtattgaatactcattctagtgttgtagaatca
gctgtagttggtatgcctcatgatatcaaaggtgaagcgatttatgtttattgcatacta
aaagatggtcatgatggcaaaggtgctggagatgaatatcttgatagtatcagaaaaaca
ttagtatcttatattagacaagaaattggtccagtcgcgagtccagatgtgattcagttt
actccagatttaccaaaaactcgttctggtaaaattatgagaagaatattgagaaaaata
gctgcaaatgattttgataatttaggtgacacatctacactttcagatccgagtatagta
gaatatctgataaaaaaacagatagtctaa

DBGET integrated database retrieval system