KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1406Help
Entry
OOM_1406          CDS       T02112                                 

Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OOM_1406
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OOM_1406
   00620 Pyruvate metabolism
    OOM_1406
   00640 Propanoate metabolism
    OOM_1406
  Energy metabolism
   00680 Methane metabolism
    OOM_1406
Enzymes [BR:fna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OOM_1406
Lipid biosynthesis proteins [BR:fna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OOM_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1407565..1409514
Genome map
AA seq 649 aa AA seqDB search
MSYSNFQVSEEFIAQANVNAEQYEAMYKESIENPEAFWSKQANYISWHKPFDKAFASSFD
PVDIQWFKGGELNVCYNCVDRHLIDKANKVAFVWQADDPYHTKNITYRDLYHRVCEMANI
LEANSVKRGDVVTIYMPMIPEAIYAMLACARIGAMHSVVFGGFSAEALKQRIINANSKFV
ITADESIRSGKRIPLKKSVDRAISGLDFVRNVLVVSRTKTKDMVWNDIDLCYEKECAKVS
DEHKIEFFDVETPLFMLYTSGSTGTPKGLVHTSGGYLVYASMTHKLAFDLKDDDVYWCTA
DIGWITGHSYAVYGPLANGCTSLIFEGVPTYPDASRMWKEVDRHNVKSLYTAPTLIRLLI
KAGDQYLKDSDRTSLIVLGSVGEPINPEVWNWFVEKGANNQAPLVDTWWQTETGGHMILP
LPGAHKLKPGSASKPFFGVDVALLDTDGKEIEGVGKGALCIRTATPGMARTIYGDHDRYI
QTYFSSFKGFYFSGDAARRDEDGYIWIEGRMDDVINVSGHRIATAEIESVLNTHSSVVES
AVVGMPHDIKGEAIYVYCILKDGHDGKGAGDEYLDSIRKTLVSYIRQEIGPVASPDVIQF
TPDLPKTRSGKIMRRILRKIAANDFDNLGDTSTLSDPSIVEYLIKKQIV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattcaaattttcaagtttcagaagagtttatagctcaagctaatgttaatgct
gagcaatatgaagccatgtataaagaatcaatagaaaatccagaggcattttggtcgaag
caggctaattatattagctggcataaaccttttgataaggctttcgcaagtagctttgat
cctgtagatattcaatggttcaaaggtggtgagctaaatgtttgttataactgtgttgac
aggcatttaatagacaaggcaaacaaggtcgcttttgtatggcaagctgatgatccatat
cacactaagaatattacgtatagagatctctatcacagagtatgtgaaatggctaatata
cttgaggcaaatagtgtcaaaagaggtgatgttgtaactatatatatgccaatgatacca
gaagcaatatatgcgatgcttgcttgtgcacgtataggagctatgcactcagttgtattt
ggaggcttttctgcagaggcacttaagcagagaattataaatgcaaatagtaaatttgta
attacagcagatgagagtatcagatcaggtaagagaatacctcttaaaaagagtgtggat
agagcaatctctggtttagactttgttaggaatgtattagttgtgagcagaactaaaaca
aaggatatggtttggaacgatatagatctttgttatgagaaagagtgtgctaaggtctct
gatgaacataagatagaattttttgatgtagaaactccattatttatgttatatacttca
ggctcaactggtactccaaaaggccttgttcatacttcaggaggttatcttgtttacgca
agtatgactcataaattagcttttgatctaaaagatgatgatgtatattggtgtacagct
gatattggctggattactgggcatagttatgctgtttatggtccgcttgctaatggttgt
acctccttaatctttgaaggtgttccaacatatccagatgcttctagaatgtggaaagaa
gttgatagacataatgtgaaatctctatatacagcaccaactttgattagattattaatt
aaagccggcgatcaataccttaaagattcagatagaacttcattaatagtattaggatct
gttggagaacctattaatccagaagtatggaactggtttgtagagaagggtgcaaataat
caagcacctcttgttgatacttggtggcaaacagagactggtggacatatgattctgcca
ttaccaggtgctcataaactaaaaccaggatcggcatctaaacctttctttggagttgat
gtagctttattagatacggatggtaaagagattgaaggagttggtaaaggagctctatgt
attagaactgcgactcctggtatggctagaactatttatggtgaccatgatagatatatt
caaacatattttagtagtttcaaaggtttctatttctcaggtgatgcagctagaagagat
gaagatggttatatctggatagaaggtcgtatggatgatgttattaatgtatcaggccat
agaatagcaactgctgaaatagaatctgtattgaatactcattctagtgttgtagaatca
gctgtagttggtatgcctcatgatatcaaaggtgaagcgatttatgtttattgcatacta
aaagatggtcatgatggcaaaggtgctggagatgaatatcttgatagtatcagaaaaaca
ttagtatcttatattagacaagaaattggtccagtcgcgagtccagatgtgattcagttt
actccagatttaccaaaaactcgttctggtaaaattatgagaagaatattgagaaaaata
gctgcaaatgattttgataatttaggtgacacatctacactttcagatccgagtatagta
gaatatctgataaaaaaacagatagtctaa

DBGET integrated database retrieval system