KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1435Help
Entry
OOM_1435          CDS       T02112                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00230  Purine metabolism
fna01100  Metabolic pathways
Module
fna_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OOM_1435
Enzymes [BR:fna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OOM_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 MMR_HSR1 AAA_23 AAA_22 ABC_tran RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AFJ43835
UniProt: I2B088
Position
1435063..1435662
Genome map
AA seq 199 aa AA seqDB search
MSNYIFIVSAPSGAGKSSLLKAFLETEIGKENFAVVTSHTTRDPRVGETNGKEYHFVSII
EFEKMLDANGFIEYAKVFKNYYGTSKSEIDKLLAQGKNIILEIDWQGAQQTRSIYQGKAK
SIFILPPSMDELRKRLEARNTDSKEIIDYRMSQAESEISHADEYDYQLVNDDFSQSLEQL
CKYFEDKYPKLITKETFGC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactatatttttatagtttctgcgccttctggtgccggtaaaagctccctatta
aaagcttttttagaaactgaaattggcaaagaaaattttgctgttgtaacatcacataca
actagagatcctcgagtaggagaaactaatggtaaagagtatcattttgtttcaattata
gagtttgaaaagatgttagatgctaatggttttatcgaatatgcaaaagttttcaaaaat
tactatggtacatctaaatctgaaatagataaattacttgcgcaaggcaaaaatataatt
cttgagattgattggcaaggtgcccaacaaacaagatctatatatcaaggcaaggcaaag
agtatatttattttacctccatctatggatgagttgagaaagcgtttagaagctagaaat
acagattctaaagagattatagactatcgaatgagtcaggctgagtctgaaatctctcat
gcagatgaatatgattatcaactcgtaaatgatgattttagtcaatcattagagcaacta
tgtaaatatttcgaagataaatatccaaagctaataactaaggagacatttggatgttaa

DBGET integrated database retrieval system