KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1491Help
Entry
OOM_1491          CDS       T02112                                 

Definition
glucosyl hydrolase family protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OOM_1491
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    OOM_1491
Enzymes [BR:fna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     OOM_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505209..1506876)
Genome map
AA seq 555 aa AA seqDB search
MPTNSNIRQKLGQLIMLDFRYWVEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRDNIQ
DNEQVISLLRDLQANTNTPIFFAIDQEGGRVNRLQQGTSGCGNMALAATDNPSNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPNVVTDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVILDKTLEELDTTELLPFRKHARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVSTTLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKEYNQNPNFANAVNNAYTSIIDFKAKHKLD
ESLIFKFSQDEQLKYANQIVNCSKHQKISLDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRMADFHNELQKIVSKNNSTTIINSENINNQNIKTGIKNADIILLISANLREYNKAY
SYVTSIKPEQTINIAALTPYDINYIDNIINYVCIYSATSMDQTNYTKTSLKINIQAALEN
IFSGNIPTGKLPVQI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaactcaaatataagacaaaaactaggtcaactaattatgttggattttcgc
tattgggttgaagattcaaataatcaacgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagattataatctaggcggttttatcctttttagagataatattcaa
gataatgagcaagttatctctctattaagagatcttcaagctaataccaatacaccaata
tttttcgctatagatcaagaaggtggtagagttaatcgcttacaacaaggtactagtggc
tgcggtaatatggcactagctgcgacagataatcctagtaatgcttatactatggctaaa
ataattggtgatgaattatattctttaggtatcaatattaattttgctccagctgtagat
gtcaactctaacaaaaacaatcctattattggtgtaaggtcttactcagataatcccaat
gtagttactgactatgccaaaaatgctataaatggttatcatgatgctaaaatcatagac
tgtattaagcactttcctggtcatggtgatactgcaacagatagtcatttaggtaatgta
atcttagataaaactttagaagaattagatactacagaattgttaccttttagaaagcat
gctagagattgtagtatgataatgacagctcatattagtgttccagccctagatgatact
cagtatcaatcagtttcaacaagcgagaatatttatgtatcaactactctttcttacaag
ataataactaaattactaaaacagcaaatgaaatttgatggtctagtagtgtcagatgct
atggacatgcatgctattgctaaacactttggaactattgaagcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaagaatataatcaaaatcctaattttgct
aatgcggttaataatgcttacacgagtattattgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagttctcacaagatgagcaattaaaatatgctaatcaaatagtt
aattgtagtaaacatcaaaagatatctttagatatagccaagcaaagtacaactgtagtc
aaaaattcaggaattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgtatggcagattttcataatgagttacaaaagatagtatcaaaaaat
aactctactactattataaactctgaaaatattaataatcaaaatataaaaacaggtatc
aaaaatgctgatataattttgctaatttcggcaaacctgcgtgaatacaataaggcttat
agttatgtaacttctataaagccagagcaaactataaatatcgcagcacttactccttat
gatattaactatatcgataatattattaattatgtttgtatttatagtgcaacttctatg
gatcagacaaactatacaaagacttcactaaagattaatattcaagcagcattagaaaat
atttttagtggtaatattccaacaggaaaattacctgttcagatttaa

DBGET integrated database retrieval system