KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1491Help
Entry
OOM_1491          CDS       T02112                                 

Definition
glucosyl hydrolase family protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fna00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:fna00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505209..1506876)
Genome map
AA seq 555 aa AA seqDB search
MPTNSNIRQKLGQLIMLDFRYWVEDSNNQRIPFTKTNDIVNKIFKDYNLGGFILFRDNIQ
DNEQVISLLRDLQANTNTPIFFAIDQEGGRVNRLQQGTSGCGNMALAATDNPSNAYTMAK
IIGDELYSLGININFAPAVDVNSNKNNPIIGVRSYSDNPNVVTDYAKNAINGYHDAKIID
CIKHFPGHGDTATDSHLGNVILDKTLEELDTTELLPFRKHARDCSMIMTAHISVPALDDT
QYQSVSTSENIYVSTTLSYKIITKLLKQQMKFDGLVVSDAMDMHAIAKHFGTIEASKLAI
LAGIDILLMPVRVWSENDLYKLEELFCELEKEYNQNPNFANAVNNAYTSIIDFKAKHKLD
ESLIFKFSQDEQLKYANQIVNCSKHQKISLDIAKQSTTVVKNSGIIPCDLNKLKNILIVD
SDNQRMADFHNELQKIVSKNNSTTIINSENINNQNIKTGIKNADIILLISANLREYNKAY
SYVTSIKPEQTINIAALTPYDINYIDNIINYVCIYSATSMDQTNYTKTSLKINIQAALEN
IFSGNIPTGKLPVQI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaactcaaatataagacaaaaactaggtcaactaattatgttggattttcgc
tattgggttgaagattcaaataatcaacgtataccttttacaaaaactaatgatatcgtc
aataagatctttaaagattataatctaggcggttttatcctttttagagataatattcaa
gataatgagcaagttatctctctattaagagatcttcaagctaataccaatacaccaata
tttttcgctatagatcaagaaggtggtagagttaatcgcttacaacaaggtactagtggc
tgcggtaatatggcactagctgcgacagataatcctagtaatgcttatactatggctaaa
ataattggtgatgaattatattctttaggtatcaatattaattttgctccagctgtagat
gtcaactctaacaaaaacaatcctattattggtgtaaggtcttactcagataatcccaat
gtagttactgactatgccaaaaatgctataaatggttatcatgatgctaaaatcatagac
tgtattaagcactttcctggtcatggtgatactgcaacagatagtcatttaggtaatgta
atcttagataaaactttagaagaattagatactacagaattgttaccttttagaaagcat
gctagagattgtagtatgataatgacagctcatattagtgttccagccctagatgatact
cagtatcaatcagtttcaacaagcgagaatatttatgtatcaactactctttcttacaag
ataataactaaattactaaaacagcaaatgaaatttgatggtctagtagtgtcagatgct
atggacatgcatgctattgctaaacactttggaactattgaagcttctaaattagctatc
ttagctggtatagatattttattaatgcctgttcgagtatggtcagaaaatgatctttat
aaattagaagagcttttttgtgaactagaaaaagaatataatcaaaatcctaattttgct
aatgcggttaataatgcttacacgagtattattgatttcaaagcaaaacataaactcgat
gaaagtttaatattcaagttctcacaagatgagcaattaaaatatgctaatcaaatagtt
aattgtagtaaacatcaaaagatatctttagatatagccaagcaaagtacaactgtagtc
aaaaattcaggaattattccatgcgatctcaataagctaaaaaatatcttgattgtagat
agtgataaccaacgtatggcagattttcataatgagttacaaaagatagtatcaaaaaat
aactctactactattataaactctgaaaatattaataatcaaaatataaaaacaggtatc
aaaaatgctgatataattttgctaatttcggcaaacctgcgtgaatacaataaggcttat
agttatgtaacttctataaagccagagcaaactataaatatcgcagcacttactccttat
gatattaactatatcgataatattattaattatgtttgtatttatagtgcaacttctatg
gatcagacaaactatacaaagacttcactaaagattaatattcaagcagcattagaaaat
atttttagtggtaatattccaacaggaaaattacctgttcagatttaa

DBGET integrated database retrieval system