KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1635Help
Entry
OOM_1635          CDS       T02112                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fna00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OOM_1635
DNA repair and recombination proteins [BR:fna03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      OOM_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641793..1642398)
Genome map
AA seq 201 aa AA seqDB search
MNNQIFSPKITAVIESLRKLPTIGKKSSQRLALYLLDKSPETAITIANSLLDAAENIKKC
KYCQSLTEKDICNICSSQNRDKSRLCIIESMIDLIAIEEAGFFKGKYFVLNGRISPLDGI
GPNELKLDILEQIIINREISEIILAISPTVEGETTAHFISQMIGKDIEISRIGFGVPFGG
ELEYLDQQTLIHAFNARTNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcaaattttctctcccaaaattactgctgtaatagaatctttgcgtaaatta
ccaactattggtaaaaaatcgtctcaaagacttgcattatatttacttgataaatctcca
gaaactgctattacaattgctaactctctgttagacgcagctgaaaatattaaaaaatgt
aaatattgccaatctctcactgaaaaagatatttgtaatatctgtagtagccaaaataga
gataaatctagattatgcataattgaaagtatgatagatttaatagctattgaagaagca
ggctttttcaaaggaaaatacttcgtactaaatggcagaatatctccgcttgatggtata
ggaccaaatgaactaaagctcgatattttagaacaaataattataaatagagaaataagt
gaaattatattagctataagccctactgtagaaggagaaacaactgctcactttatttct
caaatgattggtaaggatatagaaatctctagaattggttttggagttccttttggtggt
gaattagaatatttagaccaacaaacgttaattcacgcttttaatgctagaactaatatc
aaataa

DBGET integrated database retrieval system