KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1790Help
Entry
OOM_1790          CDS       T02112                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OOM_1790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OOM_1790
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OOM_1790
Enzymes [BR:fna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OOM_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1803205..1803657
Genome map
AA seq 150 aa AA seqDB search
MRVLNKSLKNFYKSNAGHPTALTKTRNIVKNTKTKLYLKREDLLHCGAHKTNQVLGQALL
AKRMGKNEIIAETGAGQHGVATALACALLDLKCRVYMGAKDVERQSPNVFRMRLMGAKVI
PVHSGSATLKDACNEALRDWSANYNKAHYL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagggttttaaataagagtttaaagaacttttacaagagtaatgcaggtcacccaact
gctttgacaaaaactagaaatatagtcaaaaacacaaaaactaaattatatctaaaacgc
gaagatctgctccactgcggtgctcacaaaaccaatcaagtacttggtcaagcgctactt
gccaagagaatgggtaaaaatgagataattgcagaaacaggagctggtcaacatggagtt
gcaacggctttagcgtgtgctttacttgatctaaagtgtagagtatacatgggtgctaaa
gatgttgaacgtcaaagtcctaatgtttttagaatgagattaatgggtgctaaagtcata
cctgtacatagtggttcagcaacacttaaagatgcttgtaatgaagctctaagagattgg
tctgcaaactataacaaagctcactatctatga

DBGET integrated database retrieval system