KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1791Help
Entry
OOM_1791          CDS       T02112                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fna01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fna00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fna00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1803654..1804331
Genome map
AA seq 225 aa AA seqDB search
MRHCGRTSPFSDPLADGPTIQGANLRALESGVTPKDCFDILTKIRVKYPHIPIGLLLYAN
LVYANGIENFYQKCLAVGVDSILIADVPAHESKEFRDIAKRVGISQIFIAPPDANETTLK
QMSELGSGYTYLLSRVGVTGAETAANMPVEDVLAKIREYNAPKPILGFGISKPEQVQQAI
KTGAAGAISGSATVKIIQNNLSNKVKMLSELGCFVKEMKAATKDN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaggcactgcggcaggacctcaccattttcagatccattggcagatggcccaacaatt
caaggagctaatcttcgtgctctagagagtggcgtaactcctaaagattgttttgatatc
ctcacaaaaataagagtaaaatacccgcatattcccataggcttattgctttatgctaat
ttagtttatgcaaatggtatagagaatttttatcaaaaatgtttagctgtaggtgttgat
tctatacttatagctgatgtaccagctcatgaatctaaagagtttcgcgatattgctaaa
agagtaggtatatctcagatatttatcgctccacctgatgctaatgagactactcttaaa
caaatgtctgaacttggaagtggttatacgtatttactatcgagagttggtgtaacaggt
gcagaaactgcagcaaatatgcccgtagaagatgtattagctaaaatcagagagtataat
gcacctaagccaatcttaggttttggtatctctaaaccagagcaagtacaacaagcaatc
aaaacgggtgctgctggtgcaatttcaggttctgcaacagtgaaaataattcaaaacaat
ctctcaaataaagtaaaaatgcttagcgagcttggatgttttgttaaagaaatgaaagcc
gcaactaaagataattaa

DBGET integrated database retrieval system