KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1791Help
Entry
OOM_1791          CDS       T02112                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
fna00260  Glycine, serine and threonine metabolism
fna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fna01100  Metabolic pathways
fna01110  Biosynthesis of secondary metabolites
fna01130  Biosynthesis of antibiotics
fna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OOM_1791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OOM_1791
Enzymes [BR:fna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OOM_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFJ44136
UniProt: I2B139
Position
1803654..1804331
Genome map
AA seq 225 aa AA seqDB search
MRHCGRTSPFSDPLADGPTIQGANLRALESGVTPKDCFDILTKIRVKYPHIPIGLLLYAN
LVYANGIENFYQKCLAVGVDSILIADVPAHESKEFRDIAKRVGISQIFIAPPDANETTLK
QMSELGSGYTYLLSRVGVTGAETAANMPVEDVLAKIREYNAPKPILGFGISKPEQVQQAI
KTGAAGAISGSATVKIIQNNLSNKVKMLSELGCFVKEMKAATKDN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaggcactgcggcaggacctcaccattttcagatccattggcagatggcccaacaatt
caaggagctaatcttcgtgctctagagagtggcgtaactcctaaagattgttttgatatc
ctcacaaaaataagagtaaaatacccgcatattcccataggcttattgctttatgctaat
ttagtttatgcaaatggtatagagaatttttatcaaaaatgtttagctgtaggtgttgat
tctatacttatagctgatgtaccagctcatgaatctaaagagtttcgcgatattgctaaa
agagtaggtatatctcagatatttatcgctccacctgatgctaatgagactactcttaaa
caaatgtctgaacttggaagtggttatacgtatttactatcgagagttggtgtaacaggt
gcagaaactgcagcaaatatgcccgtagaagatgtattagctaaaatcagagagtataat
gcacctaagccaatcttaggttttggtatctctaaaccagagcaagtacaacaagcaatc
aaaacgggtgctgctggtgcaatttcaggttctgcaacagtgaaaataattcaaaacaat
ctctcaaataaagtaaaaatgcttagcgagcttggatgttttgttaaagaaatgaaagcc
gcaactaaagataattaa

DBGET integrated database retrieval system