KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1830Help
Entry
OOM_1830          CDS       T02112                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fna01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fna00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1839546..1840031)
Genome map
AA seq 161 aa AA seqDB search
MKQKEIGFLQKKLSPLDVFKKEVIKTDRDFYQALESDKAVFILECKKGSHSKGVIRKKFD
LNEIAVVYKNYANMISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDEYQIYLARHY
QADAVLLMLSVLDDNEYKKLAKVANCLGMGILTEVSNEEEL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaagaaattggctttttgcaaaaaaagttatctccactagatgtattcaaa
aaagaagttatcaaaacagatagagatttttatcaggctttggagtcagacaaagcagta
tttattctagagtgcaaaaaaggatctcattctaaaggagttatccgtaaaaagtttgat
ctaaatgaaatagcagtagtgtataaaaattacgcaaatatgatatctgtacttacagat
gaagagttttttatgggtagttttgcaaatctagagattgttagaaagcaagtgactcaa
cctatgctttgtaaagattttattatagatgaatatcaaatatatttagctagacattat
caagcagatgcggtgttactgatgctttcggtattagatgataatgagtataagaaacta
gcaaaagtagctaattgtctaggtatgggtatcttaactgaagttagtaatgaagaagaa
ctttaa

DBGET integrated database retrieval system