KEGG   Francisella noatunensis subsp. orientalis Toba 04: OOM_1830Help
Entry
OOM_1830          CDS       T02112                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate (EC:4.1.1.48)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fna  Francisella noatunensis subsp. orientalis Toba 04
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OOM_1830
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OOM_1830
Enzymes [BR:fna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OOM_1830
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     OOM_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1839546..1840031)
Genome map
AA seq 161 aa AA seqDB search
MKQKEIGFLQKKLSPLDVFKKEVIKTDRDFYQALESDKAVFILECKKGSHSKGVIRKKFD
LNEIAVVYKNYANMISVLTDEEFFMGSFANLEIVRKQVTQPMLCKDFIIDEYQIYLARHY
QADAVLLMLSVLDDNEYKKLAKVANCLGMGILTEVSNEEEL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaagaaattggctttttgcaaaaaaagttatctccactagatgtattcaaa
aaagaagttatcaaaacagatagagatttttatcaggctttggagtcagacaaagcagta
tttattctagagtgcaaaaaaggatctcattctaaaggagttatccgtaaaaagtttgat
ctaaatgaaatagcagtagtgtataaaaattacgcaaatatgatatctgtacttacagat
gaagagttttttatgggtagttttgcaaatctagagattgttagaaagcaagtgactcaa
cctatgctttgtaaagattttattatagatgaatatcaaatatatttagctagacattat
caagcagatgcggtgttactgatgctttcggtattagatgataatgagtataagaaacta
gcaaaagtagctaattgtctaggtatgggtatcttaactgaagttagtaatgaagaagaa
ctttaa

DBGET integrated database retrieval system