KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_36A2: HMPREF0946_00042Help
Entry
HMPREF0946_00042  CDS       T02822                                 

Definition
hypothetical protein
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
fnc  Fusobacterium nucleatum subsp. vincentii 3_1_36A2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    HMPREF0946_00042
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0946_00042
   00330 Arginine and proline metabolism
    HMPREF0946_00042
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HMPREF0946_00042
Enzymes [BR:fnc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     HMPREF0946_00042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751180..752457
Genome map
AA seq 425 aa AA seqDB search
MSKETLNPLASGQQQVKKACDALGLDPAVYELLKEPQRIIEITIPVRMDDGSIKTFKGYR
SAHNDAVGPFKGGIRFHQNVNADEVKALSLWMSIKCQVTGIPYGGGKGGITVDPSELSQR
ELEQLSRGWVRGLWKYLGEKVDVPAPDVNTNGQIMAWMQDEYNKLSGEQTIGVFTGKPLS
YGGSQGRNEATGFGVAVTMREIFKALGKELKGATVAVQGFGNVGKYSVKNIMKLGGKVVA
VAEFEKSKGAFAVYKEAGFTFEELEAAKAAGSLTKVAGSKEISMDDFWALNVEAIAPCAL
ENAIKEHEANLIKAGIICEGANGPITPEADEILYKKGTVVTPDVLTNAGGVTVSYFEWVQ
NIYGYYWTEKEVEEKEERAMVDAFNPIWALKKEFDGKGQPISFRQATYMKSIKRIAEAMK
IRGWY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaactttaaacccactagcaagcggacaacaacaagttaaaaaagcatgt
gatgctttaggattggatccagcagtatatgaattattaaaggaacctcaaagaataata
gaaattactattcctgtaagaatggatgatggatctataaaaacatttaaaggatataga
tcagctcacaatgatgcagtaggacctttcaaaggaggaattagattccaccaaaatgtt
aatgctgatgaagtaaaagctctttctttatggatgagtattaaatgtcaagtaactgga
atcccttatggaggagggaaaggtggaattactgttgacccttctgaattatctcaaaga
gaattagaacaattatcaagaggttgggtaagaggattatggaaatacttaggtgaaaaa
gtagatgttcctgctccagatgtaaatacaaatggacaaattatggcttggatgcaagac
gaatacaataaattatctggagaacaaactattggtgtatttactggaaaacctttatct
tatggaggatctcaaggaagaaatgaagcaactggatttggtgttgctgtaactatgaga
gaaatattcaaagcattaggaaaagaattaaaaggtgcaacagttgcagttcaaggattt
ggaaatgttggaaaatactctgtaaaaaatataatgaaattaggtggaaaagttgtagca
gttgctgaatttgaaaaatcaaaaggagcatttgctgtatataaagaagctggatttaca
tttgaagaattagaagctgcaaaagctgctggaagcttaacaaaagttgctggttcaaaa
gaaatatctatggatgatttctgggctttaaatgttgaagctattgctccatgtgcatta
gaaaatgctatcaaagaacatgaagctaatttgataaaagctggaattatttgtgaagga
gcaaatggaccaataactccagaagctgatgaaattctttataaaaaaggaacagtagtt
actcctgacgttttaacaaatgcaggtggagttacagtatcttactttgaatgggtacaa
aatatttatggatactattggacagaaaaagaagttgaagaaaaagaagaaagagctatg
gttgatgcatttaatcctatatgggcattaaagaaagaatttgatggaaaaggacaacct
atttctttcagacaagctacttatatgaaatctattaagagaatagcagaagctatgaaa
attagaggatggtactaa

DBGET integrated database retrieval system