KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_36A2: HMPREF0946_00331Help
Entry
HMPREF0946_00331  CDS       T02822                                 

Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fnc  Fusobacterium nucleatum subsp. vincentii 3_1_36A2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:fnc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0946_00331
Enzymes [BR:fnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF0946_00331
Exosome [BR:fnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0946_00331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1078673..1080505)
Genome map
AA seq 610 aa AA seqDB search
MSGQVEQYLFHRGEYRQAYEYLGAHPTRSSTIFRIWAPSAKSVAVVGDFNDWIAREEDYC
RKLNNVGLWEVEIKKVKKGFLYKYQIETSWGEKILKSDPYAFYSELRPHTASIVNGKPKF
RWGDKKWLNNREIGYAKSINIYEVHLGSWKKKEDGTYYNYKEIAELLVKYMLEMNYTHIE
IMPIIEYPFDGSWGYQGTGYYSVTSRYGTPEDFMYFINYFHKNNLGVILDWVPGHFCKDS
HGLYRFDGSACYEYEDSSLGENEWGSANFNVTRNEVRSFLLSNLYFWTKEFHIDGIRMDA
VSNMLYYRDGLSENKHSVEFLQYINQSLHEEYPDVMLIAEDSSAWPLVTKYQEDGGLGFD
FKWNMGWMNDTLKYMEQDPFFRKSHHGKLTFSFMYAFSENFILPLSHDEIVHGKNSILNK
MPGYYENKLAHVKNLYSYQMAHPGKKLNFMGNEFVQGLEWRYYEQLEWQLLKDNKGSQDI
QKYVKALNQMYLEEEALWHDGQDGFEWIEHENINENMLIFLRKTLDMQDFIIAVFNFSGK
DHEKYPLGVPLEDGEYEVILDSNEKRFGGSYQGRKRKYKAIKKSWNYREQYIEIKIAKNS
AIFLKYKKEK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacaagtggaacaatatttatttcatcgtggagagtataggcaagcctatgaa
tacctaggagcacaccctacacgaagttctactatatttcgtatttgggcaccatctgca
aaatcagtagctgttgttggagattttaatgattggatagcaagagaagaagattattgc
cgaaaacttaataatgtaggtctttgggaagttgaaataaaaaaagttaaaaaaggtttt
ttatataagtatcaaatagaaacttcttggggagaaaagatattaaaatctgatccctat
gcattttattcagaacttagaccacatactgcttccattgtaaatggaaaacctaaattt
cgttggggtgataaaaaatggcttaataatagggaaataggttatgcaaaatcaattaat
atatatgaagttcaccttggctcttggaagaaaaaagaagatggaacctactataattat
aaagagatagcagaattattagtgaaatatatgttggaaatgaattacactcatattgag
attatgcctattattgaatatccatttgatggttcttggggatatcaaggtacaggatac
tattcagtaacaagccgttatggaacaccagaagattttatgtattttataaactatttt
cataaaaataatttaggagtgatattagattgggtacctggacacttttgtaaagattca
catggactatatcgttttgatggtagtgcttgttatgaatatgaagattcctctcttgga
gaaaatgaatggggtagtgcaaactttaatgttacacgaaatgaagtaagaagtttttta
ctttctaatttgtatttttggacaaaagagttccatattgatggtataagaatggatgca
gtttctaatatgctttattatagagatgggttgagtgaaaataagcattcagtggaattt
ttacaatatataaatcaaagtttacatgaagaatatccagatgttatgttgatagcagaa
gattcttctgcttggccattagtaactaaatatcaggaagatggtggacttggatttgat
tttaaatggaatatgggctggatgaatgacacattaaaatatatggaacaagatccattt
tttagaaaatcacatcatggaaaactgacattttcttttatgtatgctttttcagaaaat
tttatattaccattatcacatgatgaaatagtccatggaaaaaattctattctaaataaa
atgccaggatactatgaaaataaattagctcatgttaaaaatctatattcttatcaaatg
gctcatccaggtaaaaaattgaattttatgggaaatgaatttgtccaaggtttagagtgg
agatattatgaacaattagaatggcaattattgaaggataataaaggttcacaagatata
caaaaatatgttaaagctctaaatcaaatgtatttagaagaagaagctctttggcatgat
ggacaagatggttttgaatggatagaacatgaaaatataaatgaaaatatgttaattttt
ttaagaaaaactcttgatatgcaagattttattatagcagtatttaacttttctggaaaa
gatcatgaaaaatatcctcttggggttccattagaagatggagaatatgaagttatttta
gatagtaatgaaaagagatttggaggttcttatcaaggaagaaaaagaaaatataaggca
ataaaaaaatcttggaattatagagaacaatatatagaaataaagattgctaaaaattca
gctatatttttaaaatataaaaaggaaaaataa

DBGET integrated database retrieval system