KEGG   Fusobacterium nucleatum subsp. vincentii 3_1_36A2: HMPREF0946_01421Help
Entry
HMPREF0946_01421  CDS       T02822                                 

Definition
L-ribulose-5-phosphate 4-epimerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fnc  Fusobacterium nucleatum subsp. vincentii 3_1_36A2
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fnc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HMPREF0946_01421
Enzymes [BR:fnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HMPREF0946_01421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(588845..589513)
Genome map
AA seq 222 aa AA seqDB search
MLLENERKEIIVYGKKMITDGLTRGTGGNISICDAEQKLMAITPSGIDYFKLIPEDIVII
DVETGKIVDGSRVPSSESDMHRIFYKYRKDVFSVVHTHSKYATAISCTDIEGLPAINYLL
AVAGTDVPCAEYATYGTVKLAKNAFKAMKNKKAVLLSNHGMIAVGKNLAEAYNIAENVEF
CSELFCISKSIGSPKILSKEEMLNMIERFKDYGKRVEEHEEV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttattagaaaatgaaagaaaagaaataatagtatatggaaaaaagatgataactgat
ggtttgaccagaggtactggtggaaatataagtatatgtgatgctgaacaaaaattaatg
gcaataactccaagtggaatagattactttaaattaataccagaagatatagtaattata
gatgttgaaacaggaaaaatagttgacggaagcagagttccttccagtgaaagtgatatg
catagaattttctataaatatagaaaagacgttttttcagttgtccacactcattcaaaa
tatgcaactgcaatctcttgtactgacatagaaggattacctgcaataaattatttatta
gcagttgctggcactgatgttccctgtgctgaatatgcaacatatggaactgtaaaatta
gctaaaaatgcttttaaagcaatgaaaaataaaaaagctgtacttcttagtaaccatgga
atgatagctgttgggaaaaatttagcagaagcatataatattgccgaaaatgttgaattt
tgttcagaacttttttgtatttcaaaatcaataggatctcctaaaattttatcaaaagaa
gaaatgttaaatatgatagaaagatttaaagactatggaaaaagagttgaagaacatgag
gaggtttaa

DBGET integrated database retrieval system