KEGG   Francisella noatunensis subsp. orientalis LADL--07-285A: M973_01170Help
Entry
M973_01170        CDS       T02952                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
fnl  Francisella noatunensis subsp. orientalis LADL--07-285A
Pathway
fnl00220  Arginine biosynthesis
fnl00250  Alanine, aspartate and glutamate metabolism
fnl00471  D-Glutamine and D-glutamate metabolism
fnl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fnl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M973_01170
   00220 Arginine biosynthesis
    M973_01170
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M973_01170
Enzymes [BR:fnl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     M973_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Ank_4 Ank_2 Ank Ank_5 Ank_3 EF-hand_6
Motif
Other DBs
NCBI-ProteinID: AHB97852
Position
complement(205152..206696)
Genome map
AA seq 514 aa AA seqDB search
MKNKPIRTRSSGDEYYKNIFNAICNNDGFLTKFDIIAILDDAGITNDDPRTKKLRAELDK
LTIIDKIDFKKFKEITSDSSGIIEKSVNKGFTIPNFKDFRKEIEQIFEETKKNNTGKNAT
YIPQLARVDSELFAVTFCSVDGQMITLGDFEHPYCVQSTAKPITYCIATEENGEDKVHKH
VGREPSGITFNAIALNKYGRPHNPMINSGAIMMCSLIKPEWNLADRFEYITNVWENLAGG
ETIGFDNAVYHSEKETANRNYALAYFMKEVGAFPQNTNIDTSLDFYFQTCSIQVNAKKMS
KIMSSIANGGICPFTHKKIFSPTTIRNCLSMMYSCGMYDFSGEYAFSVGLPAKSGVSGAL
AIAIPNVGGFAIFSPRLDNNHNSVRGVEFSKRLVEKFSFHNYDHIAHCDKINPVEGRGTI
DSNLTLELIWAASNGDLPEIKRAVALSVDISKGDYDKRTALHLASAEGHEEVVKYLIRKG
ANPNAKDRWSKTPLEDAKANNHSHIVKLLEKVSS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaccaattagaactagatcttctggcgatgagtattataaaaatattttc
aatgctatctgtaacaacgatggttttttaaccaagttcgacatcatagctattctagat
gatgcaggtataactaatgatgatccacgcactaagaagttaagagctgagttagataaa
ttaactattatagacaaaattgactttaaaaaattcaaagaaataacttctgatagtagt
ggtataattgagaaatctgtcaacaaaggatttacaattccaaattttaaagatttccgt
aaagagattgaacaaatatttgaagaaactaaaaaaaataatactggcaaaaatgctaca
tatattcctcaattagcaagagtagactccgaactttttgctgttactttttgtagtgtg
gatggtcagatgattacacttggtgactttgaacatccatattgtgttcaatcaacagct
aagcctatcacatattgtatcgcaacagaggagaacggagaagataaggttcataagcat
gttggtagagaacctagtggtattacgtttaatgcaatagcactaaacaaatatggccgc
cctcacaacccgatgataaactctggtgcaataatgatgtgctcattgattaaaccagag
tggaaccttgctgatagatttgaatatataactaatgtttgggagaatctagctggtggt
gaaactataggttttgataacgctgtgtatcactctgaaaaagaaacagctaacagaaac
tatgccttagcatactttatgaaagaggttggagcatttccacagaatacaaatattgac
acttctttagatttttatttccaaacatgttctatacaagtaaatgcgaaaaaaatgtcc
aagattatgagctcaattgctaatggaggtatatgtcctttcacacacaaaaaaatattc
tctccaacaacaattcgtaactgcttatcaatgatgtactcatgcggaatgtatgatttt
tctggtgaatatgcattctcagttggattacctgctaaatccggtgtctcaggagcacta
gctatagctattcctaatgttggcggattcgcaattttttctccacgtttagataataat
cataactctgtcagaggggttgagtttagtaaaagattggtagaaaagtttagttttcat
aactatgatcatattgctcattgcgataagatcaatccagttgaaggtagaggaactata
gattcaaacctaactcttgaactaatttgggcagctagcaatggtgacttaccagaaatc
aaaagagctgtagcgttgagcgtagatattagcaaaggagactacgacaaaagaactgct
ctacatctagcttcagcagaaggtcatgaagaagtagtcaaatatcttatacgcaaaggt
gcaaatcctaacgctaaagatagatggagtaaaactcctcttgaggatgctaaagctaat
aaccattctcatatagttaaactattagaaaaagtctcttcgtaa

DBGET integrated database retrieval system